Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VUD4

Protein Details
Accession A0A397VUD4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-55TCKITAKKKQLLKKCPRQPPKKHSKLSPKECAHydrophilic
NLS Segment(s)
PositionSequence
30-48KKKQLLKKCPRQPPKKHSK
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 2, cyto 2
Family & Domain DBs
Amino Acid Sequences MYKYTIEEPCKTTTEEQDYQAKETCKITAKKKQLLKKCPRQPPKKHSKLSPKECARPPTRETCKTTYWRNVQEHPLRRKSNSSISDDTCRHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.39
4 0.43
5 0.42
6 0.42
7 0.43
8 0.37
9 0.31
10 0.29
11 0.29
12 0.3
13 0.34
14 0.4
15 0.45
16 0.52
17 0.58
18 0.64
19 0.69
20 0.71
21 0.76
22 0.78
23 0.79
24 0.8
25 0.83
26 0.86
27 0.88
28 0.89
29 0.88
30 0.89
31 0.88
32 0.83
33 0.81
34 0.82
35 0.82
36 0.8
37 0.8
38 0.75
39 0.73
40 0.73
41 0.72
42 0.66
43 0.61
44 0.57
45 0.57
46 0.59
47 0.59
48 0.59
49 0.56
50 0.59
51 0.59
52 0.62
53 0.61
54 0.61
55 0.62
56 0.61
57 0.61
58 0.64
59 0.68
60 0.7
61 0.7
62 0.72
63 0.68
64 0.66
65 0.68
66 0.64
67 0.65
68 0.62
69 0.6
70 0.57
71 0.57
72 0.62