Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UK65

Protein Details
Accession A0A397UK65    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-58DEVVKEERGRGKKRKKPQQSERQACKKNKKPYKYFGCGBasic
NLS Segment(s)
PositionSequence
27-50ERGRGKKRKKPQQSERQACKKNKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MQQKKLFLPPGEGESTEDEEDEVVKEERGRGKKRKKPQQSERQACKKNKKPYKYFGCGNFPSNSRSNSRSNSEEPPEGSTASAGHLAELPEGSTASAGHLATHDEPQEGSFTASARHLAIHDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.25
4 0.23
5 0.18
6 0.15
7 0.15
8 0.13
9 0.12
10 0.09
11 0.1
12 0.11
13 0.15
14 0.22
15 0.3
16 0.38
17 0.46
18 0.57
19 0.65
20 0.75
21 0.82
22 0.85
23 0.88
24 0.91
25 0.91
26 0.92
27 0.93
28 0.93
29 0.92
30 0.9
31 0.88
32 0.87
33 0.85
34 0.85
35 0.83
36 0.82
37 0.79
38 0.8
39 0.81
40 0.77
41 0.73
42 0.68
43 0.66
44 0.59
45 0.54
46 0.46
47 0.38
48 0.35
49 0.32
50 0.29
51 0.24
52 0.26
53 0.27
54 0.29
55 0.32
56 0.32
57 0.33
58 0.36
59 0.36
60 0.34
61 0.31
62 0.3
63 0.27
64 0.23
65 0.2
66 0.15
67 0.11
68 0.1
69 0.11
70 0.08
71 0.08
72 0.09
73 0.09
74 0.09
75 0.09
76 0.08
77 0.06
78 0.07
79 0.06
80 0.05
81 0.05
82 0.06
83 0.08
84 0.08
85 0.08
86 0.08
87 0.11
88 0.12
89 0.15
90 0.15
91 0.13
92 0.13
93 0.14
94 0.15
95 0.13
96 0.13
97 0.11
98 0.11
99 0.12
100 0.13
101 0.14
102 0.12
103 0.13