Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UZ14

Protein Details
Accession A0A397UZ14    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
37-95KKEEKEEKGKREREKKGRKREKGKRKKSKKERKGREEEKEERRKRERGGKEREREKEERBasic
NLS Segment(s)
PositionSequence
19-93KERGEKGERRKRESEGKEKKEEKEEKGKREREKKGRKREKGKRKKSKKERKGREEEKEERRKRERGGKEREREKE
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MEGHFSKKVIFENNLTGNKERGEKGERRKRESEGKEKKEEKEEKGKREREKKGRKREKGKRKKSKKERKGREEEKEERRKRERGGKEREREKEERYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.42
4 0.38
5 0.37
6 0.37
7 0.31
8 0.28
9 0.31
10 0.35
11 0.45
12 0.53
13 0.58
14 0.62
15 0.64
16 0.65
17 0.68
18 0.69
19 0.7
20 0.7
21 0.7
22 0.72
23 0.73
24 0.7
25 0.7
26 0.67
27 0.61
28 0.61
29 0.61
30 0.6
31 0.65
32 0.69
33 0.68
34 0.72
35 0.76
36 0.76
37 0.8
38 0.81
39 0.83
40 0.87
41 0.89
42 0.9
43 0.91
44 0.92
45 0.92
46 0.93
47 0.93
48 0.93
49 0.95
50 0.95
51 0.96
52 0.95
53 0.95
54 0.95
55 0.94
56 0.94
57 0.93
58 0.91
59 0.89
60 0.88
61 0.88
62 0.88
63 0.84
64 0.82
65 0.8
66 0.76
67 0.74
68 0.75
69 0.76
70 0.75
71 0.79
72 0.8
73 0.83
74 0.87
75 0.87
76 0.85
77 0.79