Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M555

Protein Details
Accession E2M555    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-37SIILWRVLKRRQDRKNKSPEELHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 8, plas 6, extr 5, golg 5, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mpr:MPER_15555  -  
Amino Acid Sequences AAISGSFLFIVALTNSIILWRVLKRRQDRKNKSPEELDNYNDAYDQKQDHMFMMRLIGPVITFVNRPWKITGKEGFERTLYSISPYHYFAVFEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.08
5 0.07
6 0.09
7 0.13
8 0.2
9 0.26
10 0.35
11 0.45
12 0.54
13 0.64
14 0.73
15 0.79
16 0.81
17 0.87
18 0.84
19 0.78
20 0.75
21 0.7
22 0.66
23 0.58
24 0.5
25 0.41
26 0.36
27 0.31
28 0.25
29 0.2
30 0.13
31 0.12
32 0.11
33 0.1
34 0.1
35 0.11
36 0.11
37 0.13
38 0.12
39 0.11
40 0.11
41 0.11
42 0.1
43 0.1
44 0.09
45 0.07
46 0.07
47 0.08
48 0.07
49 0.07
50 0.07
51 0.18
52 0.19
53 0.21
54 0.23
55 0.29
56 0.31
57 0.38
58 0.43
59 0.4
60 0.46
61 0.47
62 0.45
63 0.39
64 0.38
65 0.34
66 0.3
67 0.23
68 0.2
69 0.19
70 0.2
71 0.22
72 0.23
73 0.22
74 0.21