Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U9G5

Protein Details
Accession A0A397U9G5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-38KTYNKIIPKKKSVNQGMKKKHKTEREBasic
NLS Segment(s)
PositionSequence
21-33KKKSVNQGMKKKH
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
Amino Acid Sequences MTTPIVTSMTILKTYNKIIPKKKSVNQGMKKKHKTEREEFIHNLAKVTNKIYDGTNDGNSNSSNDNLTTTLIMASMMIPKTYIEIISRKKNISDIKKSQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.32
4 0.39
5 0.46
6 0.54
7 0.61
8 0.67
9 0.69
10 0.74
11 0.76
12 0.79
13 0.8
14 0.82
15 0.82
16 0.84
17 0.86
18 0.84
19 0.82
20 0.8
21 0.78
22 0.75
23 0.74
24 0.69
25 0.67
26 0.6
27 0.57
28 0.54
29 0.45
30 0.39
31 0.29
32 0.25
33 0.2
34 0.2
35 0.17
36 0.12
37 0.12
38 0.13
39 0.13
40 0.14
41 0.16
42 0.16
43 0.15
44 0.14
45 0.15
46 0.14
47 0.15
48 0.12
49 0.11
50 0.1
51 0.09
52 0.11
53 0.1
54 0.1
55 0.09
56 0.08
57 0.08
58 0.07
59 0.06
60 0.05
61 0.05
62 0.08
63 0.09
64 0.08
65 0.08
66 0.08
67 0.1
68 0.11
69 0.11
70 0.11
71 0.18
72 0.26
73 0.35
74 0.4
75 0.4
76 0.41
77 0.47
78 0.54
79 0.57
80 0.6