Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397WBF4

Protein Details
Accession A0A397WBF4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
55-83QVPIDAIKKKRQYKYRKRNDYKEKRFDTDHydrophilic
NLS Segment(s)
PositionSequence
63-72KKRQYKYRKR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Amino Acid Sequences MESTEQLVSFIERLVSIVNEVMKGLVLQRKRNYYRLCLCYICRRPRHLARYCLVQVPIDAIKKKRQYKYRKRNDYKEKRFDTDLNDKVQHVRFFGYMDKGVRKYLKGNRRIVESRFDGRLDKCHDRLMERNGESVNKGNENGKNDSMDVMCKMDFYKEEIEKDERKNVKVNDDRCGDLPELNDNGSIKAMSANERYGVKKDKNKASERYSKLAKSDNTCRRDNLGCHYEKGSGIENNECELFIHYQKYTNMGNPNGALDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.11
5 0.11
6 0.11
7 0.11
8 0.11
9 0.09
10 0.09
11 0.13
12 0.17
13 0.21
14 0.29
15 0.36
16 0.46
17 0.51
18 0.59
19 0.6
20 0.64
21 0.69
22 0.66
23 0.64
24 0.58
25 0.58
26 0.6
27 0.64
28 0.65
29 0.62
30 0.63
31 0.67
32 0.73
33 0.79
34 0.77
35 0.74
36 0.68
37 0.7
38 0.66
39 0.61
40 0.52
41 0.42
42 0.33
43 0.29
44 0.3
45 0.25
46 0.27
47 0.26
48 0.33
49 0.42
50 0.51
51 0.55
52 0.61
53 0.68
54 0.76
55 0.84
56 0.86
57 0.89
58 0.9
59 0.92
60 0.94
61 0.94
62 0.93
63 0.93
64 0.87
65 0.8
66 0.74
67 0.66
68 0.62
69 0.6
70 0.54
71 0.48
72 0.43
73 0.4
74 0.4
75 0.42
76 0.35
77 0.26
78 0.24
79 0.19
80 0.19
81 0.2
82 0.18
83 0.17
84 0.18
85 0.21
86 0.21
87 0.23
88 0.24
89 0.23
90 0.28
91 0.34
92 0.4
93 0.45
94 0.51
95 0.5
96 0.55
97 0.58
98 0.52
99 0.49
100 0.45
101 0.39
102 0.34
103 0.33
104 0.28
105 0.25
106 0.29
107 0.3
108 0.3
109 0.28
110 0.29
111 0.29
112 0.29
113 0.34
114 0.33
115 0.33
116 0.3
117 0.3
118 0.27
119 0.27
120 0.25
121 0.23
122 0.2
123 0.14
124 0.14
125 0.16
126 0.18
127 0.22
128 0.24
129 0.22
130 0.21
131 0.2
132 0.2
133 0.17
134 0.15
135 0.12
136 0.1
137 0.09
138 0.08
139 0.08
140 0.08
141 0.09
142 0.11
143 0.16
144 0.17
145 0.19
146 0.22
147 0.27
148 0.31
149 0.33
150 0.39
151 0.36
152 0.36
153 0.42
154 0.4
155 0.45
156 0.47
157 0.47
158 0.45
159 0.44
160 0.43
161 0.37
162 0.38
163 0.29
164 0.24
165 0.22
166 0.19
167 0.18
168 0.16
169 0.16
170 0.14
171 0.14
172 0.12
173 0.11
174 0.08
175 0.09
176 0.1
177 0.12
178 0.14
179 0.14
180 0.17
181 0.19
182 0.21
183 0.24
184 0.31
185 0.35
186 0.41
187 0.49
188 0.55
189 0.62
190 0.68
191 0.71
192 0.71
193 0.74
194 0.72
195 0.7
196 0.67
197 0.61
198 0.57
199 0.57
200 0.54
201 0.5
202 0.56
203 0.58
204 0.57
205 0.57
206 0.55
207 0.53
208 0.54
209 0.5
210 0.48
211 0.48
212 0.45
213 0.45
214 0.45
215 0.42
216 0.36
217 0.36
218 0.32
219 0.26
220 0.26
221 0.29
222 0.28
223 0.27
224 0.27
225 0.24
226 0.2
227 0.2
228 0.21
229 0.19
230 0.22
231 0.21
232 0.26
233 0.26
234 0.3
235 0.3
236 0.32
237 0.36
238 0.35
239 0.37
240 0.33