Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UF38

Protein Details
Accession A0A397UF38    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
117-140ALFLTKKSKKKESSRPKYQGPPPPHydrophilic
NLS Segment(s)
PositionSequence
122-133KKSKKKESSRPK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MTSGLSVGLQTADKMKKDMERIEKETKDKLKNMDPSRSGRDAETVYRDKYGKKIDIVAQRAEERRKIEEEEKYMKWGKEDQINKEEELRHKPLAIYKDDKELNEELKAQERWDDPAALFLTKKSKKKESSRPKYQGPPPPPNRFNIPPGYRWDGIDRSNGFEKAYFDKLNTRSALASEAYSWSVEDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.29
4 0.35
5 0.43
6 0.46
7 0.5
8 0.56
9 0.64
10 0.66
11 0.65
12 0.68
13 0.68
14 0.64
15 0.61
16 0.6
17 0.59
18 0.63
19 0.65
20 0.65
21 0.61
22 0.6
23 0.62
24 0.59
25 0.52
26 0.43
27 0.4
28 0.34
29 0.32
30 0.34
31 0.3
32 0.29
33 0.31
34 0.32
35 0.29
36 0.33
37 0.36
38 0.32
39 0.3
40 0.34
41 0.37
42 0.44
43 0.46
44 0.41
45 0.37
46 0.38
47 0.41
48 0.39
49 0.36
50 0.31
51 0.3
52 0.31
53 0.33
54 0.34
55 0.34
56 0.37
57 0.39
58 0.38
59 0.39
60 0.41
61 0.36
62 0.33
63 0.31
64 0.28
65 0.3
66 0.34
67 0.35
68 0.36
69 0.37
70 0.36
71 0.36
72 0.36
73 0.32
74 0.33
75 0.32
76 0.27
77 0.26
78 0.26
79 0.27
80 0.27
81 0.27
82 0.25
83 0.22
84 0.28
85 0.29
86 0.28
87 0.28
88 0.25
89 0.23
90 0.2
91 0.2
92 0.15
93 0.18
94 0.19
95 0.15
96 0.17
97 0.17
98 0.19
99 0.19
100 0.19
101 0.14
102 0.18
103 0.18
104 0.15
105 0.15
106 0.13
107 0.21
108 0.27
109 0.33
110 0.35
111 0.43
112 0.51
113 0.61
114 0.71
115 0.73
116 0.78
117 0.83
118 0.84
119 0.83
120 0.83
121 0.81
122 0.8
123 0.77
124 0.77
125 0.75
126 0.78
127 0.73
128 0.67
129 0.66
130 0.6
131 0.57
132 0.56
133 0.51
134 0.44
135 0.49
136 0.51
137 0.45
138 0.43
139 0.42
140 0.36
141 0.35
142 0.39
143 0.33
144 0.32
145 0.35
146 0.34
147 0.3
148 0.28
149 0.29
150 0.27
151 0.31
152 0.27
153 0.24
154 0.32
155 0.34
156 0.38
157 0.36
158 0.33
159 0.28
160 0.28
161 0.29
162 0.22
163 0.2
164 0.15
165 0.16
166 0.16
167 0.15