Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UFH1

Protein Details
Accession A0A397UFH1    Localization Confidence High Confidence Score 22.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-99MHKTFRRRKKTKNKNENEETYHIQYARPPPKKHARPPLKKRTRQPLNKCGRSPLKKHTRPPPKKHARPLNKRARQEKKKKMREKKKTNQQNERNPPCKTBasic
105-136CKNTTEKIRKTYKRRKKNKKNKNENERNPPYLHydrophilic
151-203EETYKTPLKKCTRPPLKKPPKKYARQEKKKEKMRKKNKQTKMKETHHIRCKTTBasic
NLS Segment(s)
PositionSequence
6-13RRRKKTKN
27-86RPPPKKHARPPLKKRTRQPLNKCGRSPLKKHTRPPPKKHARPLNKRARQEKKKKMREKKK
111-126KIRKTYKRRKKNKKNK
163-192RPPLKKPPKKYARQEKKKEKMRKKNKQTKM
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MHKTFRRRKKTKNKNENEETYHIQYARPPPKKHARPPLKKRTRQPLNKCGRSPLKKHTRPPPKKHARPLNKRARQEKKKKMREKKKTNQQNERNPPCKTTTEKTCKNTTEKIRKTYKRRKKNKKNKNENERNPPYLMCKTTNEETYKTTTEETYKTPLKKCTRPPLKKPPKKYARQEKKKEKMRKKNKQTKMKETHHIRCKTTTEKMCTIITKKTYKTTTEKACKTTHQEGNLME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.91
4 0.87
5 0.81
6 0.76
7 0.69
8 0.63
9 0.52
10 0.43
11 0.41
12 0.44
13 0.48
14 0.51
15 0.5
16 0.55
17 0.66
18 0.75
19 0.79
20 0.8
21 0.81
22 0.83
23 0.91
24 0.93
25 0.93
26 0.92
27 0.91
28 0.91
29 0.91
30 0.91
31 0.9
32 0.89
33 0.89
34 0.89
35 0.81
36 0.79
37 0.78
38 0.75
39 0.71
40 0.71
41 0.72
42 0.71
43 0.78
44 0.79
45 0.8
46 0.83
47 0.86
48 0.87
49 0.87
50 0.88
51 0.9
52 0.9
53 0.9
54 0.9
55 0.92
56 0.91
57 0.88
58 0.88
59 0.88
60 0.88
61 0.88
62 0.88
63 0.88
64 0.88
65 0.9
66 0.92
67 0.93
68 0.93
69 0.93
70 0.94
71 0.94
72 0.93
73 0.93
74 0.93
75 0.93
76 0.91
77 0.91
78 0.91
79 0.89
80 0.85
81 0.75
82 0.67
83 0.6
84 0.54
85 0.48
86 0.43
87 0.44
88 0.47
89 0.54
90 0.56
91 0.58
92 0.58
93 0.57
94 0.58
95 0.58
96 0.59
97 0.57
98 0.61
99 0.64
100 0.69
101 0.75
102 0.79
103 0.79
104 0.79
105 0.85
106 0.89
107 0.9
108 0.93
109 0.94
110 0.94
111 0.95
112 0.95
113 0.95
114 0.95
115 0.91
116 0.91
117 0.86
118 0.78
119 0.67
120 0.57
121 0.5
122 0.43
123 0.37
124 0.29
125 0.26
126 0.27
127 0.29
128 0.33
129 0.31
130 0.29
131 0.28
132 0.29
133 0.28
134 0.25
135 0.23
136 0.19
137 0.2
138 0.2
139 0.2
140 0.22
141 0.27
142 0.3
143 0.33
144 0.41
145 0.46
146 0.52
147 0.59
148 0.64
149 0.69
150 0.74
151 0.8
152 0.83
153 0.87
154 0.88
155 0.88
156 0.88
157 0.87
158 0.87
159 0.88
160 0.88
161 0.88
162 0.9
163 0.93
164 0.93
165 0.93
166 0.93
167 0.93
168 0.93
169 0.93
170 0.93
171 0.94
172 0.94
173 0.94
174 0.94
175 0.94
176 0.93
177 0.93
178 0.92
179 0.88
180 0.87
181 0.86
182 0.86
183 0.85
184 0.82
185 0.74
186 0.69
187 0.67
188 0.64
189 0.64
190 0.62
191 0.6
192 0.57
193 0.57
194 0.55
195 0.55
196 0.51
197 0.49
198 0.48
199 0.48
200 0.47
201 0.52
202 0.53
203 0.54
204 0.59
205 0.6
206 0.64
207 0.67
208 0.7
209 0.67
210 0.67
211 0.67
212 0.68
213 0.68
214 0.64
215 0.58