Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UB18

Protein Details
Accession A0A397UB18    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKHQKKVLRKIHRLKKRYRWSDVSIBasic
NLS Segment(s)
PositionSequence
5-18QKKVLRKIHRLKKR
Subcellular Location(s) mito 16, nucl 3, plas 3, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPKHQKKVLRKIHRLKKRYRWSDVSILYGAVLFSITCMQQNTNSIKTLILYLGSVVYIFIFLNRANYDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.89
4 0.89
5 0.87
6 0.84
7 0.8
8 0.76
9 0.76
10 0.67
11 0.6
12 0.49
13 0.39
14 0.31
15 0.24
16 0.18
17 0.09
18 0.07
19 0.03
20 0.03
21 0.04
22 0.04
23 0.05
24 0.06
25 0.06
26 0.08
27 0.13
28 0.16
29 0.18
30 0.19
31 0.18
32 0.18
33 0.18
34 0.17
35 0.13
36 0.09
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.04
44 0.05
45 0.05
46 0.05
47 0.06
48 0.07
49 0.11