Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W0Z9

Protein Details
Accession A0A397W0Z9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-73CEPGRECKPRSRCRNRHPLRYSQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 7, extr 6, E.R. 5, mito 4, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046349  C1-like_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFTRLLLVNFVFKVLTPLLLYYINYFIMLTWKQKSKYYCNYCDFDACPSHCEPGRECKPRSRCRNRHPLRYSQLSTTRGWRCNECNRISTGKHLQCHQCDYDMCSDCYFLELMVNMSLLSNSSNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.11
4 0.11
5 0.12
6 0.14
7 0.14
8 0.12
9 0.14
10 0.12
11 0.12
12 0.11
13 0.09
14 0.13
15 0.15
16 0.17
17 0.2
18 0.25
19 0.27
20 0.32
21 0.38
22 0.41
23 0.5
24 0.55
25 0.59
26 0.59
27 0.59
28 0.55
29 0.53
30 0.45
31 0.37
32 0.33
33 0.26
34 0.23
35 0.22
36 0.23
37 0.22
38 0.23
39 0.21
40 0.27
41 0.36
42 0.4
43 0.41
44 0.46
45 0.55
46 0.63
47 0.72
48 0.73
49 0.74
50 0.76
51 0.85
52 0.84
53 0.85
54 0.8
55 0.78
56 0.73
57 0.71
58 0.64
59 0.58
60 0.57
61 0.49
62 0.46
63 0.45
64 0.44
65 0.42
66 0.42
67 0.41
68 0.41
69 0.47
70 0.54
71 0.49
72 0.45
73 0.44
74 0.47
75 0.44
76 0.44
77 0.45
78 0.43
79 0.43
80 0.46
81 0.49
82 0.48
83 0.52
84 0.46
85 0.4
86 0.36
87 0.36
88 0.39
89 0.35
90 0.33
91 0.28
92 0.27
93 0.23
94 0.23
95 0.2
96 0.11
97 0.09
98 0.09
99 0.09
100 0.09
101 0.09
102 0.08
103 0.08
104 0.08
105 0.07