Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UJ47

Protein Details
Accession A0A397UJ47    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-55CEYCRFKKLKCDNGDPCKQCIKYHKECKRTKPSKKRGPKPNSKLKPNYLSIHydrophilic
NLS Segment(s)
PositionSequence
32-48KRTKPSKKRGPKPNSKL
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences ITIACEYCRFKKLKCDNGDPCKQCIKYHKECKRTKPSKKRGPKPNSKLKPNYLSITSILN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.68
4 0.74
5 0.82
6 0.73
7 0.67
8 0.65
9 0.59
10 0.52
11 0.51
12 0.51
13 0.52
14 0.6
15 0.65
16 0.68
17 0.73
18 0.79
19 0.81
20 0.83
21 0.84
22 0.84
23 0.87
24 0.87
25 0.92
26 0.92
27 0.92
28 0.92
29 0.92
30 0.91
31 0.91
32 0.9
33 0.89
34 0.87
35 0.85
36 0.82
37 0.76
38 0.71
39 0.63
40 0.56