Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TZY0

Protein Details
Accession A0A397TZY0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
14-35ITLSEKYKNPNKPRLKLNEYRFHydrophilic
153-176LFQWFENKKHKVKYFKTKQLAIEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 10.5, cyto 6, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044925  His-Me_finger_sf  
Amino Acid Sequences MSNWRSKFENFEVITLSEKYKNPNKPRLKLNEYRFVKINFKLYLEVKTQKLEITFLTDLKYFNLIQNHTWYCSKSQKDNTYYVKTNIKNKNILFHKIIYPNYKIIDHILRNGLNNRNINLRETTYNQNGLNCKLSKNNTSGYNRISKYGIYWLFQWFENKKHKVKYFKTKQLAIEFMIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.29
4 0.25
5 0.25
6 0.31
7 0.37
8 0.46
9 0.52
10 0.61
11 0.68
12 0.7
13 0.78
14 0.81
15 0.81
16 0.8
17 0.78
18 0.79
19 0.73
20 0.69
21 0.64
22 0.58
23 0.54
24 0.48
25 0.47
26 0.38
27 0.35
28 0.36
29 0.33
30 0.33
31 0.33
32 0.34
33 0.3
34 0.29
35 0.28
36 0.26
37 0.25
38 0.22
39 0.17
40 0.18
41 0.17
42 0.16
43 0.17
44 0.17
45 0.17
46 0.16
47 0.18
48 0.12
49 0.15
50 0.18
51 0.18
52 0.18
53 0.24
54 0.24
55 0.24
56 0.25
57 0.23
58 0.24
59 0.3
60 0.32
61 0.32
62 0.39
63 0.45
64 0.47
65 0.53
66 0.55
67 0.53
68 0.52
69 0.48
70 0.48
71 0.43
72 0.49
73 0.49
74 0.47
75 0.47
76 0.45
77 0.5
78 0.45
79 0.46
80 0.39
81 0.33
82 0.34
83 0.33
84 0.35
85 0.31
86 0.29
87 0.27
88 0.27
89 0.25
90 0.21
91 0.19
92 0.22
93 0.19
94 0.2
95 0.22
96 0.21
97 0.23
98 0.27
99 0.3
100 0.29
101 0.3
102 0.29
103 0.31
104 0.31
105 0.32
106 0.29
107 0.26
108 0.24
109 0.26
110 0.31
111 0.29
112 0.32
113 0.3
114 0.32
115 0.31
116 0.31
117 0.33
118 0.28
119 0.26
120 0.29
121 0.32
122 0.33
123 0.34
124 0.36
125 0.39
126 0.43
127 0.45
128 0.43
129 0.48
130 0.44
131 0.43
132 0.4
133 0.31
134 0.28
135 0.33
136 0.31
137 0.24
138 0.25
139 0.26
140 0.26
141 0.28
142 0.33
143 0.28
144 0.34
145 0.42
146 0.48
147 0.52
148 0.6
149 0.66
150 0.69
151 0.76
152 0.8
153 0.81
154 0.84
155 0.85
156 0.82
157 0.81
158 0.78
159 0.71