Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VQ60

Protein Details
Accession A0A397VQ60    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-22ISINPKQKNRILKRRIARAIFHydrophilic
NLS Segment(s)
PositionSequence
8-51QKNRILKRRIARAIFEKRYNLPKQRKPYIHESRHVHAMRRPRGP
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR001289  NFYA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF02045  CBFB_NFYA  
PROSITE View protein in PROSITE  
PS51152  NFYA_HAP2_2  
Amino Acid Sequences PISINPKQKNRILKRRIARAIFEKRYNLPKQRKPYIHESRHVHAMRRPRGPGGRFLNTNDTANARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.83
4 0.75
5 0.7
6 0.69
7 0.71
8 0.68
9 0.63
10 0.55
11 0.51
12 0.56
13 0.57
14 0.57
15 0.57
16 0.58
17 0.63
18 0.69
19 0.69
20 0.66
21 0.7
22 0.71
23 0.67
24 0.67
25 0.63
26 0.57
27 0.62
28 0.59
29 0.51
30 0.44
31 0.48
32 0.47
33 0.48
34 0.47
35 0.44
36 0.51
37 0.5
38 0.56
39 0.54
40 0.53
41 0.49
42 0.51
43 0.52
44 0.47
45 0.47
46 0.39