Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UXM9

Protein Details
Accession A0A397UXM9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-114ENLLKALERKKKSKKVNNLDDDGIHydrophilic
NLS Segment(s)
PositionSequence
99-104RKKKSK
Subcellular Location(s) cyto_nucl 14, nucl 12.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006134  DNA-dir_DNA_pol_B_multi_dom  
Gene Ontology GO:0003677  F:DNA binding  
GO:0000166  F:nucleotide binding  
Pfam View protein in Pfam  
PF00136  DNA_pol_B  
Amino Acid Sequences MANLLNEVNIELEKDNEMPYLNMAYKEVLFPVVFTEKKKYYSLEHKNKPNFNLEVVRKFNKKINIDYYTESLFAFCARFINYDEEYQLLSENLLKALERKKKSKKVNNLDDDGIVNVKDEESQNLAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.12
5 0.11
6 0.12
7 0.15
8 0.14
9 0.14
10 0.14
11 0.14
12 0.14
13 0.14
14 0.13
15 0.11
16 0.1
17 0.09
18 0.12
19 0.16
20 0.17
21 0.18
22 0.24
23 0.25
24 0.29
25 0.3
26 0.29
27 0.3
28 0.4
29 0.49
30 0.53
31 0.59
32 0.65
33 0.71
34 0.73
35 0.69
36 0.63
37 0.53
38 0.46
39 0.46
40 0.4
41 0.4
42 0.4
43 0.42
44 0.38
45 0.38
46 0.39
47 0.39
48 0.38
49 0.35
50 0.38
51 0.38
52 0.38
53 0.38
54 0.36
55 0.29
56 0.26
57 0.22
58 0.15
59 0.11
60 0.09
61 0.08
62 0.06
63 0.06
64 0.06
65 0.08
66 0.1
67 0.15
68 0.16
69 0.16
70 0.16
71 0.16
72 0.15
73 0.14
74 0.13
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.11
83 0.2
84 0.29
85 0.33
86 0.43
87 0.53
88 0.63
89 0.74
90 0.8
91 0.82
92 0.85
93 0.89
94 0.88
95 0.82
96 0.74
97 0.65
98 0.55
99 0.45
100 0.35
101 0.24
102 0.17
103 0.12
104 0.1
105 0.11
106 0.11
107 0.13
108 0.17