Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VR04

Protein Details
Accession A0A397VR04    Localization Confidence High Confidence Score 19.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-49PTMNLKRRLQRQETYYKRREREEKEKKQRKKQNKKNERTPPYSMYHydrophilic
72-104DEKHTIKEEKEKKKEKKTKQKERKKPTIFNASYBasic
NLS Segment(s)
PositionSequence
21-41KRREREEKEKKQRKKQNKKNE
78-97KEEKEKKKEKKTKQKERKKP
117-120PGKR
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MYPTPTMNLKRRLQRQETYYKRREREEKEKKQRKKQNKKNERTPPYSMYYKEKATQTIYHESNNSKSDDSNDEKHTIKEEKEKKKEKKTKQKERKKPTIFNASYKTSQDLQRTKPPPGKRARPPTGEIYKTLPKMLCSLQLEETYRKYTHDHSTRDTQDSLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.77
4 0.8
5 0.8
6 0.8
7 0.79
8 0.76
9 0.78
10 0.79
11 0.77
12 0.78
13 0.79
14 0.82
15 0.84
16 0.9
17 0.91
18 0.92
19 0.93
20 0.93
21 0.93
22 0.93
23 0.93
24 0.94
25 0.94
26 0.94
27 0.94
28 0.92
29 0.87
30 0.82
31 0.75
32 0.7
33 0.64
34 0.56
35 0.52
36 0.47
37 0.42
38 0.41
39 0.38
40 0.35
41 0.34
42 0.35
43 0.33
44 0.36
45 0.35
46 0.32
47 0.33
48 0.32
49 0.33
50 0.31
51 0.27
52 0.2
53 0.19
54 0.2
55 0.23
56 0.25
57 0.26
58 0.26
59 0.27
60 0.28
61 0.28
62 0.29
63 0.26
64 0.23
65 0.28
66 0.35
67 0.42
68 0.51
69 0.61
70 0.66
71 0.75
72 0.83
73 0.84
74 0.86
75 0.87
76 0.89
77 0.9
78 0.93
79 0.93
80 0.93
81 0.93
82 0.91
83 0.87
84 0.83
85 0.84
86 0.75
87 0.71
88 0.65
89 0.59
90 0.52
91 0.45
92 0.41
93 0.33
94 0.35
95 0.37
96 0.38
97 0.39
98 0.46
99 0.48
100 0.52
101 0.56
102 0.57
103 0.58
104 0.62
105 0.66
106 0.67
107 0.74
108 0.76
109 0.74
110 0.72
111 0.72
112 0.71
113 0.63
114 0.55
115 0.5
116 0.49
117 0.45
118 0.45
119 0.37
120 0.29
121 0.3
122 0.3
123 0.31
124 0.28
125 0.29
126 0.29
127 0.32
128 0.35
129 0.35
130 0.37
131 0.34
132 0.32
133 0.31
134 0.31
135 0.31
136 0.38
137 0.43
138 0.46
139 0.47
140 0.57
141 0.6
142 0.61
143 0.58