Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UUT5

Protein Details
Accession A0A397UUT5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-72SDSKNKAKEPVKKRPYKRKQPSFTRDYFHydrophilic
NLS Segment(s)
PositionSequence
48-63KNKAKEPVKKRPYKRK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MIDDDKYYPDEYNYEIAEDSRTLAKTFSSAATTPSIQTTYFSKLSDSKNKAKEPVKKRPYKRKQPSFTRDYFDKKVNEKGEEVRICKIINEGGQKCGTEYKSIGSSTGNLITHLSDNHEIVSRDREILKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.16
5 0.15
6 0.14
7 0.14
8 0.15
9 0.14
10 0.14
11 0.14
12 0.13
13 0.14
14 0.14
15 0.14
16 0.13
17 0.15
18 0.17
19 0.18
20 0.17
21 0.17
22 0.17
23 0.13
24 0.15
25 0.15
26 0.17
27 0.18
28 0.18
29 0.18
30 0.23
31 0.29
32 0.37
33 0.41
34 0.43
35 0.49
36 0.51
37 0.56
38 0.58
39 0.62
40 0.61
41 0.66
42 0.68
43 0.7
44 0.77
45 0.81
46 0.85
47 0.87
48 0.89
49 0.88
50 0.88
51 0.89
52 0.88
53 0.83
54 0.76
55 0.69
56 0.62
57 0.58
58 0.52
59 0.47
60 0.43
61 0.39
62 0.43
63 0.41
64 0.39
65 0.35
66 0.35
67 0.38
68 0.37
69 0.36
70 0.31
71 0.29
72 0.28
73 0.26
74 0.24
75 0.17
76 0.18
77 0.24
78 0.23
79 0.25
80 0.26
81 0.26
82 0.26
83 0.28
84 0.25
85 0.19
86 0.19
87 0.19
88 0.21
89 0.21
90 0.21
91 0.17
92 0.17
93 0.17
94 0.21
95 0.18
96 0.15
97 0.16
98 0.17
99 0.17
100 0.17
101 0.19
102 0.16
103 0.16
104 0.17
105 0.21
106 0.2
107 0.21
108 0.26
109 0.23
110 0.24
111 0.27