Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LYY8

Protein Details
Accession E2LYY8   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
147-175DVYLERLVRSPRKQRSPKKERRDSFQPHVHydrophilic
NLS Segment(s)
PositionSequence
156-168SPRKQRSPKKERR
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
KEGG mpr:MPER_12547  -  
Amino Acid Sequences MPFIDRQGIDPTTLIGKVLNRARRSSEHPALTLDFADNTSYQIKVEGYDPKWKGIPKELEMNESFDDILLSNDGFIGLEVIDCAIITLSDKAFERKRSQETDLQWDKRHLGVAFKFAEASPKWHCVWATLTEYDKDMGSCVFRSYDDVYLERLVRSPRKQRSPKKERRDSFQPHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.14
4 0.2
5 0.27
6 0.34
7 0.34
8 0.37
9 0.42
10 0.45
11 0.51
12 0.54
13 0.55
14 0.5
15 0.48
16 0.48
17 0.45
18 0.41
19 0.33
20 0.24
21 0.16
22 0.13
23 0.14
24 0.11
25 0.11
26 0.11
27 0.11
28 0.1
29 0.11
30 0.11
31 0.1
32 0.13
33 0.18
34 0.2
35 0.29
36 0.3
37 0.3
38 0.33
39 0.34
40 0.34
41 0.35
42 0.39
43 0.32
44 0.41
45 0.39
46 0.41
47 0.4
48 0.4
49 0.32
50 0.26
51 0.23
52 0.14
53 0.13
54 0.09
55 0.08
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.02
70 0.02
71 0.02
72 0.02
73 0.03
74 0.04
75 0.04
76 0.05
77 0.06
78 0.09
79 0.13
80 0.17
81 0.21
82 0.26
83 0.31
84 0.34
85 0.38
86 0.4
87 0.4
88 0.46
89 0.5
90 0.48
91 0.44
92 0.42
93 0.39
94 0.34
95 0.34
96 0.25
97 0.23
98 0.2
99 0.24
100 0.24
101 0.22
102 0.22
103 0.19
104 0.23
105 0.18
106 0.21
107 0.2
108 0.23
109 0.23
110 0.25
111 0.25
112 0.22
113 0.24
114 0.25
115 0.25
116 0.24
117 0.25
118 0.23
119 0.24
120 0.23
121 0.2
122 0.15
123 0.12
124 0.1
125 0.1
126 0.1
127 0.11
128 0.11
129 0.11
130 0.15
131 0.17
132 0.2
133 0.21
134 0.21
135 0.23
136 0.25
137 0.26
138 0.22
139 0.23
140 0.26
141 0.31
142 0.39
143 0.47
144 0.54
145 0.64
146 0.74
147 0.82
148 0.87
149 0.9
150 0.92
151 0.93
152 0.94
153 0.9
154 0.88
155 0.88