Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VPT7

Protein Details
Accession A0A397VPT7    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-38EILTKWEKQKPIKPRKKSNEYRIVKINHydrophilic
NLS Segment(s)
PositionSequence
20-28QKPIKPRKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR044925  His-Me_finger_sf  
Amino Acid Sequences MENWQDKFENFEILTKWEKQKPIKPRKKSNEYRIVKINFKLYLEIKPQKPGIIFLTDLKHFNLIQNYCCFAHKNKHHKTYYIETKLKKRNIKFHRLLYPEWKMIDHINWSGLDNRECNLRKTTPRENQLNHKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.37
4 0.36
5 0.43
6 0.48
7 0.55
8 0.62
9 0.69
10 0.74
11 0.78
12 0.84
13 0.87
14 0.9
15 0.92
16 0.92
17 0.91
18 0.86
19 0.81
20 0.79
21 0.73
22 0.66
23 0.58
24 0.52
25 0.43
26 0.39
27 0.37
28 0.29
29 0.3
30 0.33
31 0.38
32 0.34
33 0.37
34 0.37
35 0.35
36 0.33
37 0.3
38 0.25
39 0.2
40 0.19
41 0.17
42 0.2
43 0.19
44 0.19
45 0.17
46 0.17
47 0.15
48 0.16
49 0.19
50 0.17
51 0.18
52 0.18
53 0.2
54 0.19
55 0.2
56 0.19
57 0.16
58 0.25
59 0.32
60 0.41
61 0.48
62 0.56
63 0.57
64 0.59
65 0.62
66 0.62
67 0.63
68 0.62
69 0.59
70 0.55
71 0.62
72 0.68
73 0.7
74 0.68
75 0.64
76 0.65
77 0.68
78 0.74
79 0.72
80 0.71
81 0.72
82 0.68
83 0.66
84 0.64
85 0.6
86 0.53
87 0.47
88 0.39
89 0.32
90 0.3
91 0.29
92 0.25
93 0.2
94 0.19
95 0.18
96 0.19
97 0.23
98 0.24
99 0.24
100 0.21
101 0.21
102 0.28
103 0.3
104 0.32
105 0.33
106 0.37
107 0.43
108 0.5
109 0.6
110 0.6
111 0.68
112 0.74
113 0.75