Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VR30

Protein Details
Accession A0A397VR30    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-93IPNPEPKTEPNPKPNPKPNPGPTPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, mito 4, golg 3
Family & Domain DBs
Amino Acid Sequences MAKIYIAIIIFLLLNIFVNSAVPPIPSNPYDPTCHYNDTTATCYGMCVIGGGECIVQAPKQCQCVDLQPIPNPEPKTEPNPKPNPKPNPGPTPIGPIIPNPCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.06
8 0.06
9 0.07
10 0.07
11 0.09
12 0.13
13 0.13
14 0.16
15 0.2
16 0.22
17 0.25
18 0.28
19 0.3
20 0.3
21 0.32
22 0.29
23 0.26
24 0.26
25 0.25
26 0.24
27 0.21
28 0.18
29 0.15
30 0.14
31 0.13
32 0.11
33 0.07
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.05
45 0.08
46 0.1
47 0.14
48 0.14
49 0.15
50 0.16
51 0.21
52 0.26
53 0.28
54 0.29
55 0.3
56 0.34
57 0.35
58 0.39
59 0.36
60 0.31
61 0.32
62 0.32
63 0.37
64 0.43
65 0.48
66 0.53
67 0.62
68 0.7
69 0.75
70 0.81
71 0.82
72 0.8
73 0.82
74 0.8
75 0.79
76 0.75
77 0.71
78 0.63
79 0.62
80 0.56
81 0.48
82 0.41
83 0.36