Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VHK9

Protein Details
Accession A0A397VHK9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
150-185LVTNESKPKSKPKPTSKPTVKKPKKSIKAWFKKIFKHydrophilic
NLS Segment(s)
PositionSequence
156-185KPKSKPKPTSKPTVKKPKKSIKAWFKKIFK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MELLDIGQHCANPDCKRLDYLPTKCHYCKKVYCFDHSKPSEHNCNDAPSGDGERVPTCPLCGTPVPIVRGEDPNLRMEQHIAKGCHPPPATVSSKPFNSCSFNRCKERVAIRLTCSGCGKNYCIKHRLEPDHMCDKSKKGNKIMPSASELVTNESKPKSKPKPTSKPTVKKPKKSIKAWFKKIFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.36
4 0.37
5 0.43
6 0.47
7 0.51
8 0.53
9 0.54
10 0.59
11 0.59
12 0.65
13 0.61
14 0.6
15 0.61
16 0.6
17 0.65
18 0.63
19 0.67
20 0.67
21 0.67
22 0.69
23 0.63
24 0.59
25 0.55
26 0.57
27 0.58
28 0.51
29 0.51
30 0.42
31 0.43
32 0.4
33 0.35
34 0.29
35 0.21
36 0.22
37 0.18
38 0.16
39 0.14
40 0.14
41 0.15
42 0.15
43 0.13
44 0.12
45 0.12
46 0.11
47 0.14
48 0.14
49 0.15
50 0.18
51 0.22
52 0.22
53 0.23
54 0.24
55 0.22
56 0.24
57 0.23
58 0.23
59 0.2
60 0.21
61 0.2
62 0.19
63 0.18
64 0.17
65 0.17
66 0.18
67 0.21
68 0.2
69 0.21
70 0.27
71 0.27
72 0.32
73 0.3
74 0.26
75 0.23
76 0.28
77 0.29
78 0.26
79 0.29
80 0.25
81 0.27
82 0.28
83 0.28
84 0.24
85 0.26
86 0.25
87 0.27
88 0.32
89 0.37
90 0.41
91 0.41
92 0.4
93 0.41
94 0.45
95 0.46
96 0.44
97 0.41
98 0.38
99 0.43
100 0.42
101 0.38
102 0.35
103 0.3
104 0.25
105 0.24
106 0.24
107 0.24
108 0.29
109 0.33
110 0.36
111 0.37
112 0.42
113 0.49
114 0.52
115 0.53
116 0.52
117 0.52
118 0.57
119 0.56
120 0.52
121 0.46
122 0.43
123 0.45
124 0.48
125 0.49
126 0.46
127 0.51
128 0.53
129 0.6
130 0.6
131 0.52
132 0.5
133 0.45
134 0.38
135 0.35
136 0.3
137 0.26
138 0.25
139 0.23
140 0.23
141 0.24
142 0.27
143 0.29
144 0.39
145 0.44
146 0.52
147 0.62
148 0.69
149 0.77
150 0.8
151 0.88
152 0.88
153 0.89
154 0.89
155 0.9
156 0.9
157 0.89
158 0.93
159 0.93
160 0.92
161 0.9
162 0.91
163 0.9
164 0.91
165 0.91