Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U4C7

Protein Details
Accession A0A397U4C7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-37YNPFEVKHRRRTSRQQLKILHydrophilic
NLS Segment(s)
PositionSequence
74-79RAKAKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017970  Homeobox_CS  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS00027  HOMEOBOX_1  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MFDAFHQSPHGEFKPTFYNPFEVKHRRRTSRQQLKILEKAFNENPKPHAAVRQALAQKLNMTPRGVQVWFQNRRAKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.37
4 0.32
5 0.36
6 0.33
7 0.37
8 0.42
9 0.44
10 0.48
11 0.55
12 0.62
13 0.63
14 0.69
15 0.76
16 0.78
17 0.79
18 0.82
19 0.79
20 0.78
21 0.77
22 0.76
23 0.67
24 0.58
25 0.48
26 0.44
27 0.38
28 0.37
29 0.32
30 0.28
31 0.28
32 0.27
33 0.29
34 0.25
35 0.28
36 0.25
37 0.25
38 0.25
39 0.3
40 0.3
41 0.3
42 0.3
43 0.25
44 0.24
45 0.25
46 0.28
47 0.24
48 0.24
49 0.23
50 0.25
51 0.28
52 0.27
53 0.26
54 0.3
55 0.37
56 0.42
57 0.48
58 0.53
59 0.53