Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U0K3

Protein Details
Accession A0A397U0K3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-119DQNIPEKKAKKDQVKKDHKESTMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001611  Leu-rich_rpt  
IPR032675  LRR_dom_sf  
Pfam View protein in Pfam  
PF13516  LRR_6  
Amino Acid Sequences MSITRHKLQKAADDNDATNENDAGNDNDTADDNDTADDNDAANKKEVPSDNEAPSDNKAPNDNEAPSDNVVRDRRKDAPIFGNFLEVSWPNVLNELDQNIPEKKAKKDQVKKDHKESTMLCRDGRINRHSLQTSTLTSLTLSNYRLDNESSKAVVDFLNKNNTLISLELCYNQLGLKEGKVFLLTICKDANNKLDSDAGKMLSGTFLKNNCILVFLDLKNNQLGSEGVGKAIADVLHKNITLTSLDLRDNQLGPEGGKAIADALCENSTLTYLELCSNSFGRMVNTLRNITYKSSAVIYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.46
4 0.37
5 0.29
6 0.24
7 0.18
8 0.15
9 0.15
10 0.14
11 0.13
12 0.13
13 0.12
14 0.13
15 0.14
16 0.15
17 0.15
18 0.14
19 0.12
20 0.12
21 0.12
22 0.12
23 0.12
24 0.11
25 0.09
26 0.14
27 0.16
28 0.17
29 0.19
30 0.19
31 0.19
32 0.25
33 0.29
34 0.29
35 0.34
36 0.38
37 0.39
38 0.4
39 0.41
40 0.36
41 0.36
42 0.35
43 0.29
44 0.25
45 0.26
46 0.25
47 0.28
48 0.3
49 0.28
50 0.26
51 0.26
52 0.27
53 0.24
54 0.24
55 0.21
56 0.24
57 0.29
58 0.31
59 0.33
60 0.36
61 0.4
62 0.44
63 0.46
64 0.45
65 0.48
66 0.46
67 0.46
68 0.41
69 0.39
70 0.32
71 0.29
72 0.26
73 0.18
74 0.16
75 0.14
76 0.14
77 0.1
78 0.13
79 0.13
80 0.11
81 0.12
82 0.12
83 0.11
84 0.11
85 0.14
86 0.13
87 0.16
88 0.19
89 0.22
90 0.24
91 0.33
92 0.41
93 0.49
94 0.57
95 0.65
96 0.73
97 0.8
98 0.82
99 0.82
100 0.81
101 0.72
102 0.68
103 0.6
104 0.58
105 0.55
106 0.51
107 0.42
108 0.36
109 0.38
110 0.38
111 0.41
112 0.35
113 0.31
114 0.31
115 0.36
116 0.35
117 0.32
118 0.3
119 0.26
120 0.24
121 0.22
122 0.2
123 0.15
124 0.14
125 0.14
126 0.12
127 0.12
128 0.11
129 0.11
130 0.11
131 0.12
132 0.12
133 0.13
134 0.13
135 0.13
136 0.13
137 0.12
138 0.12
139 0.11
140 0.1
141 0.1
142 0.12
143 0.13
144 0.14
145 0.2
146 0.2
147 0.2
148 0.19
149 0.19
150 0.16
151 0.13
152 0.12
153 0.07
154 0.08
155 0.09
156 0.09
157 0.09
158 0.08
159 0.08
160 0.08
161 0.09
162 0.08
163 0.09
164 0.1
165 0.1
166 0.1
167 0.1
168 0.1
169 0.08
170 0.14
171 0.14
172 0.14
173 0.14
174 0.15
175 0.16
176 0.18
177 0.23
178 0.18
179 0.18
180 0.17
181 0.21
182 0.2
183 0.22
184 0.22
185 0.17
186 0.16
187 0.15
188 0.14
189 0.12
190 0.12
191 0.1
192 0.12
193 0.13
194 0.15
195 0.16
196 0.17
197 0.15
198 0.16
199 0.15
200 0.14
201 0.17
202 0.16
203 0.21
204 0.21
205 0.22
206 0.21
207 0.21
208 0.19
209 0.15
210 0.15
211 0.1
212 0.15
213 0.13
214 0.12
215 0.12
216 0.12
217 0.11
218 0.12
219 0.11
220 0.07
221 0.08
222 0.11
223 0.13
224 0.13
225 0.13
226 0.12
227 0.13
228 0.12
229 0.13
230 0.14
231 0.14
232 0.16
233 0.18
234 0.2
235 0.22
236 0.22
237 0.2
238 0.2
239 0.18
240 0.17
241 0.17
242 0.15
243 0.12
244 0.12
245 0.11
246 0.1
247 0.09
248 0.1
249 0.09
250 0.1
251 0.11
252 0.11
253 0.11
254 0.1
255 0.1
256 0.1
257 0.1
258 0.08
259 0.09
260 0.12
261 0.12
262 0.13
263 0.15
264 0.15
265 0.16
266 0.16
267 0.16
268 0.15
269 0.2
270 0.22
271 0.26
272 0.31
273 0.33
274 0.33
275 0.36
276 0.36
277 0.34
278 0.36
279 0.3
280 0.27