Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VJR7

Protein Details
Accession A0A397VJR7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-44AQNKMSDYKNKNKTKGKKKVKFVDSPVHydrophilic
NLS Segment(s)
PositionSequence
28-36KNKTKGKKK
Subcellular Location(s) nucl 17.5, mito_nucl 13.5, mito 8.5
Family & Domain DBs
Amino Acid Sequences MTKKIKHALDRTRPTTAAQNKMSDYKNKNKTKGKKKVKFVDSPVVANFDNKSQEVVLTKKLRPVNEKLEGREYGVSVKKRTSEVCSTWNKAIKIELGLKKQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.56
4 0.54
5 0.48
6 0.46
7 0.44
8 0.49
9 0.5
10 0.48
11 0.47
12 0.49
13 0.56
14 0.6
15 0.66
16 0.7
17 0.78
18 0.8
19 0.85
20 0.86
21 0.84
22 0.87
23 0.88
24 0.85
25 0.82
26 0.77
27 0.75
28 0.65
29 0.58
30 0.48
31 0.41
32 0.34
33 0.27
34 0.22
35 0.14
36 0.14
37 0.12
38 0.12
39 0.09
40 0.1
41 0.11
42 0.12
43 0.18
44 0.21
45 0.21
46 0.27
47 0.3
48 0.32
49 0.35
50 0.4
51 0.4
52 0.45
53 0.48
54 0.45
55 0.47
56 0.44
57 0.41
58 0.36
59 0.29
60 0.25
61 0.28
62 0.29
63 0.26
64 0.28
65 0.28
66 0.3
67 0.33
68 0.34
69 0.35
70 0.35
71 0.42
72 0.47
73 0.49
74 0.53
75 0.56
76 0.51
77 0.44
78 0.43
79 0.37
80 0.35
81 0.4
82 0.4