Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UJJ8

Protein Details
Accession A0A397UJJ8    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-106VCENDKEKIRAKRDVRKREKERDRKRKRVGEKKRKRKKERERRGKEKGRERESKRESERERKRKRKRKRKEREEYKEEKRKMERERKREKERKREKEKFFSIBasic
NLS Segment(s)
PositionSequence
11-102EKIRAKRDVRKREKERDRKRKRVGEKKRKRKKERERRGKEKGRERESKRESERERKRKRKRKRKEREEYKEEKRKMERERKREKERKREKEK
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
Amino Acid Sequences MYMCVCENDKEKIRAKRDVRKREKERDRKRKRVGEKKRKRKKERERRGKEKGRERESKRESERERKRKRKRKRKEREEYKEEKRKMERERKREKERKREKEKFFSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.71
4 0.75
5 0.8
6 0.82
7 0.84
8 0.88
9 0.89
10 0.91
11 0.92
12 0.93
13 0.93
14 0.93
15 0.93
16 0.94
17 0.93
18 0.92
19 0.92
20 0.92
21 0.92
22 0.93
23 0.93
24 0.94
25 0.95
26 0.95
27 0.95
28 0.95
29 0.94
30 0.95
31 0.95
32 0.94
33 0.93
34 0.93
35 0.92
36 0.89
37 0.88
38 0.86
39 0.82
40 0.81
41 0.77
42 0.77
43 0.73
44 0.73
45 0.67
46 0.67
47 0.66
48 0.67
49 0.72
50 0.72
51 0.79
52 0.81
53 0.87
54 0.89
55 0.93
56 0.94
57 0.94
58 0.95
59 0.95
60 0.95
61 0.96
62 0.97
63 0.96
64 0.94
65 0.92
66 0.92
67 0.9
68 0.82
69 0.79
70 0.75
71 0.73
72 0.74
73 0.76
74 0.75
75 0.76
76 0.84
77 0.86
78 0.9
79 0.92
80 0.92
81 0.92
82 0.93
83 0.93
84 0.93
85 0.93
86 0.91