Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TWX8

Protein Details
Accession A0A397TWX8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-34VITSWEKYKNPNKPRLKLNEYCHydrophilic
154-175FQWFENKKHKVKYFKTKQLAIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 10, mito 7.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR044925  His-Me_finger_sf  
Amino Acid Sequences MSNWRSKFENFEVITSWEKYKNPNKPRLKLNEYCLVKINFKLYLEVKTQKLEITFLTDLKYFNLIQNHTWYCSKLQKDNTYYVKTNIKNKNILFHKIIYPNYKIIDHILRNGLDNRNINLRETTYNQNGLNCKLSKNNTSGYNGISKYGIYWLFQWFENKKHKVKYFKTKQLAIEFKLKHNKITGNQNGYPVNYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.33
4 0.28
5 0.28
6 0.36
7 0.43
8 0.5
9 0.56
10 0.64
11 0.71
12 0.74
13 0.82
14 0.83
15 0.82
16 0.78
17 0.74
18 0.74
19 0.67
20 0.61
21 0.57
22 0.5
23 0.43
24 0.39
25 0.35
26 0.28
27 0.26
28 0.28
29 0.24
30 0.25
31 0.28
32 0.31
33 0.3
34 0.29
35 0.29
36 0.26
37 0.25
38 0.22
39 0.17
40 0.19
41 0.18
42 0.17
43 0.18
44 0.17
45 0.17
46 0.17
47 0.19
48 0.13
49 0.15
50 0.19
51 0.19
52 0.19
53 0.25
54 0.25
55 0.26
56 0.26
57 0.24
58 0.24
59 0.29
60 0.3
61 0.3
62 0.36
63 0.41
64 0.44
65 0.5
66 0.52
67 0.5
68 0.48
69 0.45
70 0.46
71 0.42
72 0.48
73 0.48
74 0.46
75 0.47
76 0.46
77 0.51
78 0.47
79 0.47
80 0.4
81 0.34
82 0.34
83 0.33
84 0.35
85 0.3
86 0.29
87 0.26
88 0.25
89 0.24
90 0.2
91 0.18
92 0.21
93 0.18
94 0.18
95 0.19
96 0.18
97 0.2
98 0.23
99 0.22
100 0.21
101 0.22
102 0.21
103 0.24
104 0.25
105 0.24
106 0.22
107 0.22
108 0.21
109 0.23
110 0.27
111 0.24
112 0.27
113 0.27
114 0.29
115 0.29
116 0.28
117 0.3
118 0.25
119 0.24
120 0.26
121 0.3
122 0.3
123 0.31
124 0.34
125 0.32
126 0.34
127 0.34
128 0.3
129 0.32
130 0.29
131 0.26
132 0.22
133 0.18
134 0.15
135 0.18
136 0.17
137 0.12
138 0.13
139 0.15
140 0.17
141 0.18
142 0.25
143 0.23
144 0.31
145 0.4
146 0.45
147 0.49
148 0.56
149 0.63
150 0.67
151 0.74
152 0.77
153 0.78
154 0.82
155 0.83
156 0.8
157 0.79
158 0.79
159 0.76
160 0.68
161 0.66
162 0.58
163 0.59
164 0.64
165 0.58
166 0.51
167 0.5
168 0.53
169 0.51
170 0.59
171 0.6
172 0.57
173 0.59
174 0.61
175 0.57