Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VP33

Protein Details
Accession A0A397VP33    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
153-177WMQNAIKKTKRARKIGKKIRACIIIHydrophilic
NLS Segment(s)
PositionSequence
159-171KKTKRARKIGKKI
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MVGINTRRTDCSDAEWIEYCNMSQIRNNETPSEWMKRIWERLIYFRENNLFPSESNKYLEARKIIRLPNSGSYASEIGIAICFSCDQLVYTGQRKKNIGNYNHIGIERHWKFSCTGNKYCSVSYDEYLLKVKKKSILGYNYDNEYTLHRYELWMQNAIKKTKRARKIGKKIRACIIIQCKFIEYYYHPDGLRALELAQHYKLLWVIREEMHQINNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.32
4 0.29
5 0.28
6 0.22
7 0.21
8 0.2
9 0.18
10 0.21
11 0.24
12 0.3
13 0.35
14 0.37
15 0.33
16 0.33
17 0.37
18 0.38
19 0.41
20 0.34
21 0.31
22 0.35
23 0.39
24 0.42
25 0.41
26 0.42
27 0.38
28 0.45
29 0.5
30 0.5
31 0.45
32 0.44
33 0.45
34 0.39
35 0.38
36 0.34
37 0.29
38 0.23
39 0.28
40 0.28
41 0.25
42 0.26
43 0.26
44 0.24
45 0.26
46 0.3
47 0.29
48 0.27
49 0.3
50 0.34
51 0.37
52 0.4
53 0.4
54 0.39
55 0.39
56 0.4
57 0.35
58 0.29
59 0.27
60 0.23
61 0.2
62 0.17
63 0.12
64 0.08
65 0.08
66 0.07
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.08
76 0.11
77 0.17
78 0.24
79 0.26
80 0.3
81 0.31
82 0.32
83 0.39
84 0.44
85 0.41
86 0.42
87 0.42
88 0.4
89 0.41
90 0.38
91 0.31
92 0.23
93 0.3
94 0.24
95 0.25
96 0.23
97 0.22
98 0.23
99 0.29
100 0.37
101 0.34
102 0.36
103 0.35
104 0.39
105 0.39
106 0.38
107 0.33
108 0.29
109 0.24
110 0.2
111 0.21
112 0.18
113 0.17
114 0.21
115 0.21
116 0.21
117 0.2
118 0.22
119 0.24
120 0.26
121 0.29
122 0.33
123 0.37
124 0.39
125 0.43
126 0.43
127 0.4
128 0.38
129 0.34
130 0.27
131 0.24
132 0.22
133 0.17
134 0.16
135 0.13
136 0.14
137 0.2
138 0.26
139 0.26
140 0.28
141 0.28
142 0.33
143 0.39
144 0.43
145 0.41
146 0.42
147 0.49
148 0.53
149 0.61
150 0.66
151 0.71
152 0.77
153 0.85
154 0.88
155 0.89
156 0.88
157 0.84
158 0.82
159 0.76
160 0.66
161 0.63
162 0.63
163 0.58
164 0.52
165 0.47
166 0.41
167 0.36
168 0.35
169 0.31
170 0.24
171 0.26
172 0.28
173 0.31
174 0.3
175 0.29
176 0.3
177 0.27
178 0.25
179 0.18
180 0.14
181 0.13
182 0.16
183 0.18
184 0.18
185 0.17
186 0.16
187 0.17
188 0.19
189 0.18
190 0.18
191 0.18
192 0.21
193 0.22
194 0.25
195 0.28
196 0.29