Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397URN0

Protein Details
Accession A0A397URN0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
57-83PDISRRNHTPCKVKRKKKIFNDTASESHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MVNNSCETVGFGNNTSKLVSKIVKPISHRRISISLRQLLKIVKPEVRQELINAIANPDISRRNHTPCKVKRKKKIFNDTASESSSSSGKYCEKALKMFQVGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.19
5 0.21
6 0.22
7 0.2
8 0.28
9 0.33
10 0.37
11 0.41
12 0.5
13 0.55
14 0.58
15 0.56
16 0.52
17 0.53
18 0.53
19 0.55
20 0.52
21 0.49
22 0.45
23 0.45
24 0.42
25 0.36
26 0.34
27 0.31
28 0.27
29 0.25
30 0.25
31 0.28
32 0.3
33 0.3
34 0.28
35 0.23
36 0.22
37 0.19
38 0.19
39 0.15
40 0.12
41 0.11
42 0.11
43 0.1
44 0.1
45 0.12
46 0.11
47 0.17
48 0.2
49 0.27
50 0.34
51 0.4
52 0.49
53 0.54
54 0.65
55 0.7
56 0.77
57 0.8
58 0.84
59 0.89
60 0.89
61 0.91
62 0.89
63 0.86
64 0.83
65 0.79
66 0.71
67 0.63
68 0.53
69 0.42
70 0.34
71 0.27
72 0.21
73 0.15
74 0.16
75 0.16
76 0.17
77 0.21
78 0.27
79 0.29
80 0.34
81 0.39
82 0.43