Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UB03

Protein Details
Accession A0A397UB03    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
102-124IEVREQKVVPYKQRRKAQPKRLRHydrophilic
NLS Segment(s)
PositionSequence
114-124QRRKAQPKRLR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTRIEIAEKHSSNNKHDAPGEQEVIRCRKLVARIFGLEKTVKKLERDVGFLETELEDLGDNVDKGTVVDLIHEIVLTLINEKSKSSPDSSDSSEESDSVEIIEVREQKVVPYKQRRKAQPKRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.44
4 0.43
5 0.42
6 0.42
7 0.41
8 0.33
9 0.33
10 0.35
11 0.37
12 0.35
13 0.29
14 0.24
15 0.25
16 0.32
17 0.36
18 0.35
19 0.35
20 0.37
21 0.39
22 0.39
23 0.38
24 0.33
25 0.28
26 0.27
27 0.28
28 0.27
29 0.26
30 0.29
31 0.32
32 0.31
33 0.33
34 0.3
35 0.27
36 0.25
37 0.23
38 0.21
39 0.14
40 0.12
41 0.09
42 0.07
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.04
53 0.05
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.07
67 0.08
68 0.08
69 0.1
70 0.12
71 0.15
72 0.16
73 0.18
74 0.2
75 0.24
76 0.27
77 0.29
78 0.27
79 0.27
80 0.25
81 0.22
82 0.2
83 0.16
84 0.13
85 0.1
86 0.09
87 0.07
88 0.07
89 0.12
90 0.13
91 0.14
92 0.16
93 0.16
94 0.18
95 0.27
96 0.33
97 0.39
98 0.48
99 0.57
100 0.65
101 0.75
102 0.83
103 0.85
104 0.89