Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VEM6

Protein Details
Accession A0A397VEM6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
54-107RGREEKKKGERGRVRKKERERKRKREREKEREKEKEREREKEREREREKREREIBasic
NLS Segment(s)
PositionSequence
42-107REREREREEERGRGREEKKKGERGRVRKKERERKRKREREKEREKEKEREREKEREREREKREREI
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MAASMEPLGGPLKLDTKSKQSGNIKVIICVPYRDSFLYEREREREREREEERGRGREEKKKGERGRVRKKERERKRKREREKEREKEKEREREKEREREREKREREI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.27
4 0.33
5 0.34
6 0.42
7 0.45
8 0.51
9 0.5
10 0.55
11 0.48
12 0.43
13 0.44
14 0.38
15 0.32
16 0.25
17 0.25
18 0.19
19 0.21
20 0.2
21 0.19
22 0.18
23 0.22
24 0.28
25 0.28
26 0.29
27 0.31
28 0.34
29 0.36
30 0.39
31 0.43
32 0.4
33 0.45
34 0.45
35 0.5
36 0.49
37 0.53
38 0.51
39 0.47
40 0.45
41 0.45
42 0.47
43 0.45
44 0.49
45 0.51
46 0.55
47 0.6
48 0.63
49 0.66
50 0.7
51 0.73
52 0.79
53 0.79
54 0.82
55 0.81
56 0.88
57 0.88
58 0.9
59 0.91
60 0.91
61 0.91
62 0.94
63 0.95
64 0.95
65 0.95
66 0.96
67 0.95
68 0.96
69 0.95
70 0.94
71 0.94
72 0.9
73 0.89
74 0.87
75 0.86
76 0.83
77 0.82
78 0.78
79 0.78
80 0.8
81 0.8
82 0.8
83 0.8
84 0.81
85 0.81
86 0.84
87 0.84