Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VD53

Protein Details
Accession A0A397VD53    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-28TIIETRGAARNRKKRERRAATLDVPKLHydrophilic
NLS Segment(s)
PositionSequence
10-19ARNRKKRERR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.333, mito 5.5, cyto_mito 4.999, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTIIETRGAARNRKKRERRAATLDVPKLHSLRYKLSLYIYIFYVPVIIVKVFIDSEEENLKEPNSYYPPLYSNLDLLLSSLLYQSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.88
4 0.89
5 0.88
6 0.87
7 0.85
8 0.82
9 0.81
10 0.74
11 0.65
12 0.58
13 0.51
14 0.42
15 0.36
16 0.31
17 0.25
18 0.25
19 0.27
20 0.26
21 0.24
22 0.25
23 0.28
24 0.25
25 0.23
26 0.2
27 0.15
28 0.14
29 0.12
30 0.11
31 0.06
32 0.06
33 0.05
34 0.05
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.07
41 0.07
42 0.09
43 0.11
44 0.12
45 0.12
46 0.13
47 0.13
48 0.11
49 0.12
50 0.15
51 0.17
52 0.18
53 0.19
54 0.2
55 0.22
56 0.25
57 0.28
58 0.23
59 0.2
60 0.19
61 0.19
62 0.16
63 0.15
64 0.12
65 0.09
66 0.08
67 0.09