Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UHC3

Protein Details
Accession A0A397UHC3    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
105-135REQKAVPHKQQRKTWPRKIKIKKAVEKCRSEBasic
220-242SEFREFKTKRAVRKRLYRPGGTLHydrophilic
NLS Segment(s)
PositionSequence
113-127KQQRKTWPRKIKIKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MTRIEITEKHSSNNKRDAPGEQEVIRYRKLVARIFGLEKTVKKLERDVASLETELEDLDDCVDKSTVVDLIHKIVTSLINEKGKSSSYSSDSSEKSDSVEIIEVREQKAVPHKQQRKTWPRKIKIKKAVEKCRSEIKIYEVEWEKNRYTRYMLTKYGLNNINNLKTPEAWLQFAKYHPPEYIRRRLLILGYDINRKVHWRNFVFRIKNHLTRNESIANNSEFREFKTKRAVRKRLYRPGGTLMKRAQDRYYQNANKLENCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.56
3 0.58
4 0.57
5 0.56
6 0.54
7 0.51
8 0.43
9 0.43
10 0.45
11 0.46
12 0.42
13 0.36
14 0.32
15 0.31
16 0.36
17 0.35
18 0.32
19 0.33
20 0.37
21 0.39
22 0.38
23 0.38
24 0.35
25 0.32
26 0.35
27 0.36
28 0.35
29 0.33
30 0.37
31 0.41
32 0.4
33 0.41
34 0.38
35 0.34
36 0.33
37 0.31
38 0.27
39 0.2
40 0.16
41 0.13
42 0.1
43 0.07
44 0.06
45 0.06
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.08
52 0.09
53 0.1
54 0.1
55 0.12
56 0.11
57 0.14
58 0.15
59 0.14
60 0.13
61 0.12
62 0.13
63 0.12
64 0.14
65 0.17
66 0.21
67 0.21
68 0.22
69 0.22
70 0.22
71 0.22
72 0.22
73 0.2
74 0.2
75 0.22
76 0.24
77 0.28
78 0.27
79 0.28
80 0.27
81 0.23
82 0.21
83 0.19
84 0.16
85 0.12
86 0.14
87 0.11
88 0.11
89 0.14
90 0.14
91 0.14
92 0.15
93 0.14
94 0.14
95 0.23
96 0.27
97 0.32
98 0.41
99 0.49
100 0.55
101 0.62
102 0.71
103 0.73
104 0.78
105 0.8
106 0.8
107 0.81
108 0.85
109 0.88
110 0.88
111 0.87
112 0.86
113 0.85
114 0.84
115 0.86
116 0.83
117 0.77
118 0.69
119 0.68
120 0.59
121 0.52
122 0.43
123 0.36
124 0.33
125 0.29
126 0.32
127 0.26
128 0.27
129 0.28
130 0.3
131 0.27
132 0.26
133 0.26
134 0.22
135 0.22
136 0.25
137 0.3
138 0.31
139 0.33
140 0.31
141 0.33
142 0.33
143 0.37
144 0.37
145 0.3
146 0.29
147 0.3
148 0.3
149 0.29
150 0.3
151 0.24
152 0.18
153 0.21
154 0.22
155 0.21
156 0.2
157 0.19
158 0.2
159 0.21
160 0.22
161 0.26
162 0.22
163 0.22
164 0.22
165 0.26
166 0.33
167 0.38
168 0.48
169 0.44
170 0.43
171 0.43
172 0.43
173 0.4
174 0.34
175 0.29
176 0.25
177 0.25
178 0.29
179 0.28
180 0.28
181 0.27
182 0.28
183 0.3
184 0.3
185 0.37
186 0.36
187 0.42
188 0.49
189 0.58
190 0.61
191 0.57
192 0.61
193 0.59
194 0.62
195 0.61
196 0.61
197 0.58
198 0.54
199 0.57
200 0.55
201 0.48
202 0.43
203 0.42
204 0.37
205 0.33
206 0.31
207 0.3
208 0.24
209 0.27
210 0.35
211 0.31
212 0.33
213 0.43
214 0.47
215 0.54
216 0.64
217 0.71
218 0.7
219 0.8
220 0.85
221 0.85
222 0.88
223 0.82
224 0.76
225 0.75
226 0.75
227 0.68
228 0.64
229 0.58
230 0.58
231 0.57
232 0.56
233 0.5
234 0.49
235 0.51
236 0.52
237 0.59
238 0.57
239 0.6
240 0.64
241 0.65