Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397U8D5

Protein Details
Accession A0A397U8D5    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-58TCREENPEKEKKKERERKREREREKESECEBasic
61-132REKDREREREKERKREREKERKRERESEKKRESEKEKTRERERKRKKKERKERKREKEKKKKKRKKRKRERNBasic
NLS Segment(s)
PositionSequence
37-132KEKKKERERKREREREKESECEREREKDREREREKERKREREKERKRERESEKKRESEKEKTRERERKRKKKERKERKREKEKKKKKRKKRKRERN
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MKKQLLKEENKMFEKHNDCEFRSRSNNGTCREENPEKEKKKERERKREREREKESECEREREKDREREREKERKREREKERKRERESEKKRESEKEKTRERERKRKKKERKERKREKEKKKKKRKKRKRERN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.52
4 0.49
5 0.48
6 0.54
7 0.53
8 0.52
9 0.51
10 0.51
11 0.48
12 0.51
13 0.56
14 0.52
15 0.57
16 0.51
17 0.48
18 0.54
19 0.53
20 0.5
21 0.5
22 0.55
23 0.53
24 0.6
25 0.66
26 0.66
27 0.72
28 0.77
29 0.8
30 0.82
31 0.88
32 0.91
33 0.92
34 0.94
35 0.91
36 0.92
37 0.89
38 0.87
39 0.8
40 0.77
41 0.69
42 0.68
43 0.61
44 0.55
45 0.49
46 0.46
47 0.46
48 0.46
49 0.49
50 0.48
51 0.53
52 0.59
53 0.61
54 0.63
55 0.67
56 0.7
57 0.71
58 0.72
59 0.76
60 0.76
61 0.81
62 0.82
63 0.85
64 0.86
65 0.89
66 0.89
67 0.91
68 0.9
69 0.88
70 0.88
71 0.87
72 0.87
73 0.86
74 0.86
75 0.83
76 0.8
77 0.78
78 0.77
79 0.75
80 0.74
81 0.74
82 0.72
83 0.74
84 0.75
85 0.81
86 0.82
87 0.85
88 0.86
89 0.87
90 0.89
91 0.91
92 0.93
93 0.94
94 0.95
95 0.96
96 0.96
97 0.97
98 0.97
99 0.97
100 0.97
101 0.97
102 0.97
103 0.97
104 0.97
105 0.97
106 0.97
107 0.97
108 0.97
109 0.96
110 0.97
111 0.97
112 0.97