Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UCM3

Protein Details
Accession A0A397UCM3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
132-157AWKRIDNCKLRRKGFKHQVHFSRTPCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 3, cyto 2, cysk 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDNRKVESVGLSKNLDVNDPFFQDLCKTYADYLNSSTTLINKKLAFYNSITYTVLESNQDSVRATNKLDPVLECPIYYIQKPEESRWVLTSINCTGLIKLIFRCDTDNSRFGMAVMLNCTWLPGFMSLISIAWKRIDNCKLRRKGFKHQVHFSRTPCLESEESILQEHHTDFFGSKKEKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.24
4 0.23
5 0.21
6 0.22
7 0.22
8 0.19
9 0.19
10 0.19
11 0.19
12 0.18
13 0.16
14 0.15
15 0.16
16 0.2
17 0.22
18 0.22
19 0.22
20 0.23
21 0.22
22 0.22
23 0.2
24 0.2
25 0.22
26 0.22
27 0.24
28 0.22
29 0.24
30 0.27
31 0.28
32 0.27
33 0.24
34 0.28
35 0.25
36 0.27
37 0.25
38 0.21
39 0.21
40 0.19
41 0.17
42 0.13
43 0.12
44 0.12
45 0.12
46 0.12
47 0.11
48 0.12
49 0.14
50 0.14
51 0.15
52 0.16
53 0.18
54 0.18
55 0.19
56 0.18
57 0.19
58 0.22
59 0.2
60 0.16
61 0.15
62 0.17
63 0.17
64 0.17
65 0.15
66 0.13
67 0.18
68 0.2
69 0.2
70 0.25
71 0.25
72 0.26
73 0.25
74 0.25
75 0.2
76 0.19
77 0.21
78 0.14
79 0.14
80 0.13
81 0.12
82 0.1
83 0.11
84 0.11
85 0.09
86 0.09
87 0.11
88 0.11
89 0.12
90 0.14
91 0.15
92 0.2
93 0.22
94 0.24
95 0.23
96 0.23
97 0.22
98 0.2
99 0.19
100 0.14
101 0.11
102 0.11
103 0.1
104 0.1
105 0.1
106 0.1
107 0.08
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.09
117 0.09
118 0.09
119 0.1
120 0.13
121 0.14
122 0.22
123 0.3
124 0.37
125 0.46
126 0.55
127 0.63
128 0.68
129 0.76
130 0.75
131 0.78
132 0.8
133 0.81
134 0.8
135 0.81
136 0.82
137 0.81
138 0.81
139 0.72
140 0.7
141 0.61
142 0.54
143 0.45
144 0.42
145 0.34
146 0.3
147 0.32
148 0.26
149 0.26
150 0.25
151 0.24
152 0.19
153 0.2
154 0.2
155 0.16
156 0.13
157 0.13
158 0.13
159 0.16
160 0.23