Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VUX8

Protein Details
Accession A0A397VUX8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-47KVKSQTPKVEKQEKKKKKTGRAKKRILYNRRFVBasic
NLS Segment(s)
PositionSequence
13-41AGKVKSQTPKVEKQEKKKKKTGRAKKRIL
Subcellular Location(s) nucl 12.5, mito_nucl 12, mito 10.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MSNGKVHGSLARAGKVKSQTPKVEKQEKKKKKTGRAKKRILYNRRFVNVANIGKRRMNPAPTSDKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.37
4 0.4
5 0.45
6 0.48
7 0.52
8 0.6
9 0.64
10 0.7
11 0.7
12 0.74
13 0.78
14 0.79
15 0.81
16 0.81
17 0.81
18 0.81
19 0.85
20 0.85
21 0.85
22 0.86
23 0.87
24 0.84
25 0.85
26 0.85
27 0.84
28 0.81
29 0.78
30 0.75
31 0.68
32 0.63
33 0.53
34 0.51
35 0.49
36 0.48
37 0.47
38 0.42
39 0.44
40 0.46
41 0.47
42 0.46
43 0.44
44 0.44
45 0.41
46 0.45