Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397W5A1

Protein Details
Accession A0A397W5A1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
36-61NLICEYKKSGRKRGPKSKKQSFETMIHydrophilic
NLS Segment(s)
PositionSequence
42-54KKSGRKRGPKSKK
Subcellular Location(s) nucl 17.5, mito_nucl 13.666, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MRKRKQPYIGLACTNCRKSHARCSGNPICERCVNRNLICEYKKSGRKRGPKSKKQSFETMIDLKDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.49
3 0.44
4 0.44
5 0.42
6 0.5
7 0.54
8 0.52
9 0.52
10 0.6
11 0.63
12 0.63
13 0.63
14 0.54
15 0.47
16 0.45
17 0.45
18 0.4
19 0.37
20 0.36
21 0.32
22 0.34
23 0.34
24 0.35
25 0.34
26 0.32
27 0.33
28 0.37
29 0.44
30 0.46
31 0.52
32 0.55
33 0.64
34 0.73
35 0.79
36 0.82
37 0.85
38 0.9
39 0.9
40 0.91
41 0.86
42 0.85
43 0.78
44 0.72
45 0.69
46 0.63