Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VPX0

Protein Details
Accession A0A397VPX0    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
75-102AKVSLQNPKRRKPKECPKSSKRIKQLEEHydrophilic
NLS Segment(s)
PositionSequence
82-98PKRRKPKECPKSSKRIK
Subcellular Location(s) nucl 24, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MSCNTNKLFTPLADLQSERKEVITERKMYGELWENLLTEIQEDVLANDSNSDGEETYSDSNNKDNENDKENELLAKVSLQNPKRRKPKECPKSSKRIKQLEELKLAKRQNQCGNCGEYGHYRPRCSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.32
4 0.33
5 0.26
6 0.23
7 0.21
8 0.22
9 0.31
10 0.34
11 0.33
12 0.33
13 0.34
14 0.35
15 0.33
16 0.34
17 0.31
18 0.25
19 0.25
20 0.24
21 0.22
22 0.22
23 0.22
24 0.18
25 0.11
26 0.1
27 0.06
28 0.06
29 0.05
30 0.05
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.07
38 0.07
39 0.05
40 0.05
41 0.05
42 0.07
43 0.08
44 0.09
45 0.1
46 0.1
47 0.12
48 0.13
49 0.13
50 0.14
51 0.17
52 0.18
53 0.22
54 0.23
55 0.22
56 0.21
57 0.21
58 0.19
59 0.15
60 0.13
61 0.08
62 0.08
63 0.08
64 0.12
65 0.19
66 0.23
67 0.32
68 0.39
69 0.48
70 0.58
71 0.64
72 0.67
73 0.71
74 0.78
75 0.8
76 0.84
77 0.85
78 0.83
79 0.87
80 0.9
81 0.89
82 0.87
83 0.86
84 0.78
85 0.77
86 0.78
87 0.75
88 0.73
89 0.68
90 0.62
91 0.6
92 0.59
93 0.57
94 0.54
95 0.55
96 0.55
97 0.56
98 0.57
99 0.55
100 0.57
101 0.51
102 0.45
103 0.4
104 0.37
105 0.38
106 0.44
107 0.44
108 0.44