Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397V9S9

Protein Details
Accession A0A397V9S9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-69TTLRTMTPRKKAIKKKKINLNSDLHydrophilic
NLS Segment(s)
PositionSequence
53-62PRKKAIKKKK
Subcellular Location(s) nucl 14, mito_nucl 13.833, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MTPRMMTPKTTTLRTTISRMTTPRTTTSRIMTPRMTTPKKTTPRMTTLRTMTPRKKAIKKKKINLNSDLLQRQANRTPNNLYEVIFEHHSKNFFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.38
4 0.37
5 0.38
6 0.38
7 0.41
8 0.4
9 0.39
10 0.41
11 0.4
12 0.4
13 0.39
14 0.4
15 0.41
16 0.4
17 0.41
18 0.37
19 0.35
20 0.38
21 0.45
22 0.45
23 0.41
24 0.44
25 0.5
26 0.55
27 0.58
28 0.58
29 0.53
30 0.57
31 0.59
32 0.56
33 0.52
34 0.47
35 0.48
36 0.48
37 0.5
38 0.47
39 0.49
40 0.53
41 0.55
42 0.62
43 0.66
44 0.72
45 0.75
46 0.81
47 0.83
48 0.86
49 0.87
50 0.84
51 0.79
52 0.74
53 0.67
54 0.64
55 0.57
56 0.47
57 0.42
58 0.36
59 0.35
60 0.35
61 0.38
62 0.34
63 0.36
64 0.4
65 0.39
66 0.43
67 0.4
68 0.34
69 0.28
70 0.29
71 0.28
72 0.26
73 0.25
74 0.23
75 0.26