Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397W635

Protein Details
Accession A0A397W635    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-55QNYDPYFSSKKKKKETFKLSFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 10.666, cyto_nucl 9.333, mito 8.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036075  ARMT-1-like_metal-bd_sf  
IPR039763  ARMT1  
IPR002791  ARMT1-like_metal-bd  
Gene Ontology GO:0097023  F:fructose 6-phosphate aldolase activity  
GO:0103026  F:fructose-1-phosphatase activity  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01937  ARMT1-like_dom  
Amino Acid Sequences MSFKDENWFTATWLFAENYLYRRIISIITNTKHWQNYDPYFSSKKKKKETFKLSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.13
4 0.14
5 0.14
6 0.16
7 0.16
8 0.14
9 0.14
10 0.14
11 0.13
12 0.12
13 0.16
14 0.2
15 0.21
16 0.23
17 0.24
18 0.27
19 0.28
20 0.28
21 0.26
22 0.27
23 0.31
24 0.34
25 0.36
26 0.37
27 0.41
28 0.46
29 0.53
30 0.54
31 0.59
32 0.64
33 0.71
34 0.77
35 0.82