Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U1R2

Protein Details
Accession A0A397U1R2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-79NETTNSKNKKKGGKKLTWPTIILHydrophilic
NLS Segment(s)
PositionSequence
65-70KKKGGK
Subcellular Location(s) nucl 13, cyto 10, mito 2
Family & Domain DBs
Amino Acid Sequences MSTDIEDNDLYTFEFTRIITEIENEITINDPTDDDTEDEFEDEIDEESESEADESENETTNSKNKKKGGKKLTWPTIILWTLLEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.11
4 0.11
5 0.12
6 0.11
7 0.12
8 0.13
9 0.12
10 0.12
11 0.1
12 0.09
13 0.1
14 0.1
15 0.09
16 0.08
17 0.07
18 0.08
19 0.09
20 0.09
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.06
43 0.07
44 0.08
45 0.09
46 0.1
47 0.17
48 0.26
49 0.29
50 0.35
51 0.41
52 0.51
53 0.6
54 0.7
55 0.73
56 0.74
57 0.8
58 0.84
59 0.87
60 0.82
61 0.73
62 0.65
63 0.62
64 0.53
65 0.43