Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397U5Z0

Protein Details
Accession A0A397U5Z0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-48KITNEKLAKKCARCFRQRKKCDHEKGLSKKCLNCMKYKKEKKACLIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
Amino Acid Sequences MTKITNEKLAKKCARCFRQRKKCDHEKGLSKKCLNCMKYKKEKKACLIQCKECYKKNKDVKEGPFPQCKNCKEITKDSPDELIEENGKIYFIPGNGKQYEINEGYRPGTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.82
4 0.83
5 0.86
6 0.88
7 0.9
8 0.89
9 0.9
10 0.9
11 0.88
12 0.86
13 0.85
14 0.86
15 0.86
16 0.84
17 0.78
18 0.7
19 0.69
20 0.69
21 0.61
22 0.6
23 0.6
24 0.61
25 0.68
26 0.75
27 0.77
28 0.78
29 0.82
30 0.79
31 0.8
32 0.78
33 0.77
34 0.75
35 0.71
36 0.7
37 0.7
38 0.68
39 0.64
40 0.63
41 0.59
42 0.61
43 0.63
44 0.62
45 0.63
46 0.66
47 0.66
48 0.68
49 0.7
50 0.66
51 0.66
52 0.6
53 0.59
54 0.59
55 0.55
56 0.49
57 0.46
58 0.48
59 0.45
60 0.52
61 0.53
62 0.53
63 0.54
64 0.5
65 0.48
66 0.41
67 0.37
68 0.3
69 0.25
70 0.18
71 0.15
72 0.15
73 0.12
74 0.12
75 0.1
76 0.1
77 0.09
78 0.08
79 0.14
80 0.17
81 0.23
82 0.24
83 0.26
84 0.27
85 0.27
86 0.33
87 0.3
88 0.3
89 0.26
90 0.28