Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V3B4

Protein Details
Accession A0A397V3B4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-37ATQACTNCQNKRQKCKRLSDRDACENCKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MPQQRSRNHATQACTNCQNKRQKCKRLSDRDACENCKNNKSRCVIIWGRKRGRKPSPNQTTEAVNEFQFSSSNFETLLLDDQSIVLINPYASASRTTDVFINQEPTHNYHVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.59
3 0.57
4 0.6
5 0.66
6 0.66
7 0.71
8 0.75
9 0.77
10 0.81
11 0.86
12 0.88
13 0.89
14 0.9
15 0.88
16 0.85
17 0.85
18 0.82
19 0.76
20 0.72
21 0.69
22 0.64
23 0.62
24 0.62
25 0.55
26 0.57
27 0.54
28 0.5
29 0.43
30 0.46
31 0.45
32 0.47
33 0.53
34 0.55
35 0.59
36 0.61
37 0.65
38 0.66
39 0.69
40 0.69
41 0.68
42 0.69
43 0.71
44 0.69
45 0.67
46 0.6
47 0.52
48 0.45
49 0.4
50 0.3
51 0.2
52 0.17
53 0.15
54 0.13
55 0.11
56 0.1
57 0.13
58 0.12
59 0.12
60 0.11
61 0.12
62 0.12
63 0.12
64 0.14
65 0.09
66 0.09
67 0.09
68 0.08
69 0.08
70 0.08
71 0.07
72 0.04
73 0.04
74 0.04
75 0.05
76 0.06
77 0.06
78 0.07
79 0.1
80 0.11
81 0.12
82 0.13
83 0.14
84 0.15
85 0.16
86 0.19
87 0.19
88 0.23
89 0.22
90 0.26
91 0.28
92 0.31