Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TU69

Protein Details
Accession A0A397TU69    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
24-44PDSLIKNKRWRDFRKKINLFSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, mito 8, cyto_nucl 7, plas 4, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEKFLVDSSMVETTIKINALLALPDSLIKNKRWRDFRKKINLFSPSAHFGLILSISFNSWAISVPLFRSLSISVSVKVNCKELRCNSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.1
4 0.08
5 0.09
6 0.09
7 0.09
8 0.09
9 0.07
10 0.07
11 0.08
12 0.09
13 0.12
14 0.15
15 0.18
16 0.26
17 0.33
18 0.4
19 0.48
20 0.58
21 0.64
22 0.71
23 0.78
24 0.81
25 0.8
26 0.77
27 0.75
28 0.69
29 0.6
30 0.52
31 0.45
32 0.37
33 0.31
34 0.26
35 0.19
36 0.14
37 0.13
38 0.11
39 0.08
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.08
52 0.13
53 0.13
54 0.13
55 0.15
56 0.15
57 0.16
58 0.19
59 0.19
60 0.16
61 0.2
62 0.22
63 0.25
64 0.26
65 0.31
66 0.31
67 0.33
68 0.4