Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397VJJ8

Protein Details
Accession A0A397VJJ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-87APVHTPIKPPARRKKPYESEDHRPCYYHydrophilic
NLS Segment(s)
PositionSequence
71-74ARRK
Subcellular Location(s) extr 9, cyto 4, E.R. 4, mito 3, cyto_nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MELRAYLILFIIFIVCSTASAVPVVHRNKHRGKPIPTVNHQEKVTLTALAVKTPVKPPVNAPVHTPIKPPARRKKPYESEDHRPCYYGKRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.07
5 0.07
6 0.07
7 0.08
8 0.08
9 0.09
10 0.17
11 0.2
12 0.25
13 0.29
14 0.37
15 0.45
16 0.52
17 0.59
18 0.61
19 0.63
20 0.66
21 0.71
22 0.71
23 0.68
24 0.7
25 0.65
26 0.61
27 0.55
28 0.47
29 0.38
30 0.33
31 0.28
32 0.19
33 0.15
34 0.14
35 0.13
36 0.13
37 0.13
38 0.11
39 0.12
40 0.14
41 0.21
42 0.18
43 0.19
44 0.21
45 0.3
46 0.35
47 0.34
48 0.35
49 0.37
50 0.4
51 0.4
52 0.4
53 0.37
54 0.42
55 0.49
56 0.55
57 0.58
58 0.64
59 0.72
60 0.77
61 0.81
62 0.81
63 0.81
64 0.82
65 0.79
66 0.79
67 0.81
68 0.8
69 0.7
70 0.62
71 0.56