Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UVN7

Protein Details
Accession A0A397UVN7    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-31ELLEKLRKFRFGKKSQKGTSAFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 12.5, cyto 10, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002108  ADF-H  
IPR029006  ADF-H/Gelsolin-like_dom_sf  
IPR011171  GMF  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0003779  F:actin binding  
GO:0071933  F:Arp2/3 complex binding  
GO:0071846  P:actin filament debranching  
Pfam View protein in Pfam  
PF00241  Cofilin_ADF  
PROSITE View protein in PROSITE  
PS51263  ADF_H  
CDD cd11283  ADF_GMF-beta_like  
Amino Acid Sequences MSSTCEVDPELLEKLRKFRFGKKSQKGTSAFVLKIDMAKLLVIEDVLYDDISLEDLVEELPENTPRYIVLSYELSHRDGRKSFPLVLIYYSPPSSKPEIHMLYASAKTYFQQKADLNKVFDIREAEELTNEWLREKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.4
4 0.42
5 0.48
6 0.56
7 0.63
8 0.72
9 0.74
10 0.81
11 0.77
12 0.82
13 0.76
14 0.69
15 0.66
16 0.6
17 0.5
18 0.4
19 0.36
20 0.28
21 0.25
22 0.22
23 0.15
24 0.09
25 0.09
26 0.08
27 0.07
28 0.06
29 0.05
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.05
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.06
49 0.08
50 0.08
51 0.08
52 0.08
53 0.1
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.13
60 0.14
61 0.15
62 0.17
63 0.18
64 0.19
65 0.19
66 0.21
67 0.23
68 0.25
69 0.24
70 0.24
71 0.25
72 0.23
73 0.23
74 0.22
75 0.19
76 0.17
77 0.17
78 0.15
79 0.14
80 0.16
81 0.18
82 0.18
83 0.19
84 0.26
85 0.27
86 0.28
87 0.28
88 0.26
89 0.26
90 0.26
91 0.24
92 0.17
93 0.15
94 0.14
95 0.2
96 0.21
97 0.19
98 0.24
99 0.28
100 0.36
101 0.44
102 0.49
103 0.44
104 0.45
105 0.47
106 0.4
107 0.39
108 0.33
109 0.26
110 0.26
111 0.26
112 0.23
113 0.22
114 0.22
115 0.24
116 0.25
117 0.22
118 0.19