Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TX33

Protein Details
Accession A0A397TX33    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
162-184ENKDISSCCKKKKNSKNSYYVITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025659  Tubby-like_C  
IPR000007  Tubby_C  
Pfam View protein in Pfam  
PF01167  Tub  
Amino Acid Sequences MNISPSIISAINNLSINESNNDGALEDEQSVIDDDDDDDDDDEEMELGENSRTIRSNYNQYSQTRNFTGSTASFNGSTSTLSQPVAPAELLHAVVINRPTAQMIETFRFSKPRVEITEQEVINFVMNPVPQGQKVLCKITRSKEGFGKLYPQYLLYIEEPIENKDISSCCKKKKNSKNSYYVITTSRLDSAASSKKIVGKVRRSPFKREPELSDMQLREELGAVVYDPNIKVYIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.2
5 0.2
6 0.17
7 0.17
8 0.16
9 0.13
10 0.12
11 0.11
12 0.11
13 0.09
14 0.09
15 0.08
16 0.09
17 0.1
18 0.09
19 0.08
20 0.07
21 0.07
22 0.08
23 0.09
24 0.09
25 0.09
26 0.09
27 0.09
28 0.09
29 0.08
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.07
38 0.09
39 0.1
40 0.12
41 0.18
42 0.21
43 0.31
44 0.35
45 0.4
46 0.44
47 0.45
48 0.51
49 0.49
50 0.5
51 0.41
52 0.39
53 0.34
54 0.29
55 0.29
56 0.22
57 0.22
58 0.19
59 0.19
60 0.16
61 0.16
62 0.17
63 0.14
64 0.14
65 0.12
66 0.12
67 0.12
68 0.12
69 0.12
70 0.11
71 0.11
72 0.12
73 0.09
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.06
81 0.08
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.1
91 0.12
92 0.14
93 0.15
94 0.16
95 0.19
96 0.19
97 0.21
98 0.21
99 0.24
100 0.26
101 0.29
102 0.31
103 0.32
104 0.37
105 0.33
106 0.31
107 0.26
108 0.22
109 0.17
110 0.15
111 0.11
112 0.06
113 0.06
114 0.06
115 0.07
116 0.08
117 0.08
118 0.1
119 0.1
120 0.14
121 0.16
122 0.22
123 0.22
124 0.24
125 0.28
126 0.31
127 0.4
128 0.39
129 0.4
130 0.39
131 0.42
132 0.41
133 0.37
134 0.39
135 0.31
136 0.29
137 0.26
138 0.22
139 0.18
140 0.17
141 0.19
142 0.13
143 0.13
144 0.11
145 0.13
146 0.13
147 0.14
148 0.15
149 0.12
150 0.11
151 0.13
152 0.14
153 0.16
154 0.26
155 0.3
156 0.37
157 0.46
158 0.55
159 0.63
160 0.73
161 0.8
162 0.8
163 0.84
164 0.85
165 0.81
166 0.78
167 0.71
168 0.63
169 0.54
170 0.46
171 0.38
172 0.3
173 0.26
174 0.21
175 0.17
176 0.15
177 0.19
178 0.24
179 0.25
180 0.25
181 0.26
182 0.3
183 0.35
184 0.42
185 0.45
186 0.47
187 0.55
188 0.64
189 0.72
190 0.72
191 0.76
192 0.78
193 0.79
194 0.79
195 0.74
196 0.71
197 0.68
198 0.7
199 0.64
200 0.62
201 0.52
202 0.44
203 0.41
204 0.34
205 0.27
206 0.22
207 0.18
208 0.11
209 0.1
210 0.09
211 0.08
212 0.09
213 0.11
214 0.11
215 0.12