Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397V5I7

Protein Details
Accession A0A397V5I7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-73EDEKDEKMRRRRQEDKKKGKKGKKPSRKKAGTTSKRLWBasic
NLS Segment(s)
PositionSequence
28-79KTRRRERQEDEKDEKMRRRRQEDKKKGKKGKKPSRKKAGTTSKRLWGLEEKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLEFATKPWKLQNSGDLVEKEVLVKDEKTRRRERQEDEKDEKMRRRRQEDKKKGKKGKKPSRKKAGTTSKRLWGLEEKKTKNKQAIIIVYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.39
4 0.36
5 0.32
6 0.29
7 0.23
8 0.17
9 0.16
10 0.13
11 0.14
12 0.18
13 0.27
14 0.34
15 0.42
16 0.5
17 0.58
18 0.66
19 0.73
20 0.73
21 0.75
22 0.79
23 0.8
24 0.76
25 0.75
26 0.7
27 0.68
28 0.67
29 0.65
30 0.63
31 0.61
32 0.63
33 0.66
34 0.72
35 0.78
36 0.82
37 0.85
38 0.88
39 0.91
40 0.92
41 0.92
42 0.9
43 0.9
44 0.9
45 0.89
46 0.9
47 0.9
48 0.91
49 0.9
50 0.86
51 0.85
52 0.85
53 0.84
54 0.82
55 0.76
56 0.73
57 0.7
58 0.64
59 0.57
60 0.56
61 0.53
62 0.54
63 0.58
64 0.57
65 0.62
66 0.7
67 0.73
68 0.71
69 0.7
70 0.67
71 0.66