Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UJ02

Protein Details
Accession A0A397UJ02    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
66-106ITNYKEFKKRKLPQQKKKKLPKKQSHNKIKKLLKKQNQNKKBasic
NLS Segment(s)
PositionSequence
73-106KKRKLPQQKKKKLPKKQSHNKIKKLLKKQNQNKK
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MPRVKKSEFYKILGIKSTATLLEIKQAYRKFALVFHPDRNVNKSENKRLEAEKKFKEIQEAYDYLITNYKEFKKRKLPQQKKKKLPKKQSHNKIKKLLKKQNQNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.36
3 0.32
4 0.29
5 0.2
6 0.17
7 0.15
8 0.11
9 0.17
10 0.17
11 0.17
12 0.22
13 0.23
14 0.25
15 0.25
16 0.26
17 0.2
18 0.22
19 0.28
20 0.29
21 0.32
22 0.32
23 0.36
24 0.38
25 0.39
26 0.39
27 0.35
28 0.31
29 0.35
30 0.39
31 0.44
32 0.45
33 0.45
34 0.45
35 0.47
36 0.53
37 0.52
38 0.53
39 0.46
40 0.46
41 0.46
42 0.44
43 0.45
44 0.37
45 0.32
46 0.29
47 0.27
48 0.23
49 0.24
50 0.23
51 0.18
52 0.21
53 0.18
54 0.14
55 0.17
56 0.22
57 0.28
58 0.31
59 0.38
60 0.45
61 0.53
62 0.63
63 0.71
64 0.76
65 0.79
66 0.88
67 0.91
68 0.91
69 0.95
70 0.94
71 0.93
72 0.94
73 0.94
74 0.94
75 0.94
76 0.94
77 0.94
78 0.95
79 0.93
80 0.92
81 0.91
82 0.9
83 0.9
84 0.9
85 0.88
86 0.89