Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VDX4

Protein Details
Accession A0A397VDX4    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-116SLPCKNFEKTVRKKVKKTQKEEYFCNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 7, mito 5
Family & Domain DBs
Amino Acid Sequences MPKAPIYKVPFEIFVNIFDNLDDNLNALHFAQICKYLARSFKLYNYPTPGRDVLISLTTNHIKPKRFYFSRSTIGKRKREPLYIEFDPESLPCKNFEKTVRKKVKKTQKEEYFCNSPFQSNEKLVYVKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.23
4 0.2
5 0.17
6 0.17
7 0.13
8 0.14
9 0.11
10 0.08
11 0.08
12 0.08
13 0.08
14 0.07
15 0.08
16 0.08
17 0.08
18 0.09
19 0.11
20 0.12
21 0.13
22 0.14
23 0.16
24 0.19
25 0.22
26 0.26
27 0.25
28 0.3
29 0.37
30 0.37
31 0.38
32 0.41
33 0.41
34 0.37
35 0.39
36 0.34
37 0.27
38 0.25
39 0.22
40 0.15
41 0.15
42 0.14
43 0.11
44 0.13
45 0.14
46 0.14
47 0.19
48 0.21
49 0.22
50 0.23
51 0.29
52 0.34
53 0.35
54 0.38
55 0.4
56 0.42
57 0.47
58 0.5
59 0.5
60 0.51
61 0.58
62 0.61
63 0.59
64 0.61
65 0.58
66 0.59
67 0.58
68 0.54
69 0.54
70 0.48
71 0.47
72 0.39
73 0.34
74 0.29
75 0.24
76 0.22
77 0.15
78 0.15
79 0.14
80 0.17
81 0.18
82 0.22
83 0.31
84 0.38
85 0.46
86 0.57
87 0.66
88 0.71
89 0.78
90 0.83
91 0.86
92 0.86
93 0.84
94 0.85
95 0.84
96 0.82
97 0.81
98 0.78
99 0.75
100 0.66
101 0.64
102 0.54
103 0.47
104 0.42
105 0.41
106 0.39
107 0.34
108 0.36
109 0.33