Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397VDK9

Protein Details
Accession A0A397VDK9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-39NITDSKKKKTMSRIKRARKLWIQKKEDHydrophilic
NLS Segment(s)
PositionSequence
18-48KKKKTMSRIKRARKLWIQKKEDHVANKEGRK
Subcellular Location(s) nucl 9.5, mito_nucl 9.333, mito 8, cyto_mito 5.833, plas 5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MYNMNKYVLYNNNITDSKKKKTMSRIKRARKLWIQKKEDHVANKEGRKRLYSGFRYNLSRGALHYHSGEETPILWIQVYSQENSKIVVLQKWSNDILTIFGMLSVTMLFSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.39
4 0.42
5 0.47
6 0.49
7 0.5
8 0.59
9 0.67
10 0.69
11 0.74
12 0.78
13 0.82
14 0.87
15 0.85
16 0.83
17 0.82
18 0.83
19 0.82
20 0.81
21 0.76
22 0.73
23 0.76
24 0.72
25 0.67
26 0.61
27 0.55
28 0.51
29 0.52
30 0.52
31 0.51
32 0.48
33 0.45
34 0.41
35 0.4
36 0.38
37 0.41
38 0.41
39 0.41
40 0.41
41 0.43
42 0.44
43 0.42
44 0.4
45 0.32
46 0.26
47 0.2
48 0.21
49 0.18
50 0.17
51 0.17
52 0.14
53 0.13
54 0.13
55 0.13
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.06
62 0.06
63 0.07
64 0.13
65 0.14
66 0.13
67 0.16
68 0.17
69 0.18
70 0.19
71 0.19
72 0.15
73 0.16
74 0.18
75 0.2
76 0.22
77 0.23
78 0.26
79 0.26
80 0.24
81 0.23
82 0.2
83 0.18
84 0.15
85 0.14
86 0.1
87 0.09
88 0.09
89 0.07
90 0.07
91 0.05