Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UIR7

Protein Details
Accession A0A397UIR7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-45LSSKNKTLSKKLKTQKTQKSQPKFSTNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
Amino Acid Sequences MSTIKRNYGIYCEDNESDLSSKNKTLSKKLKTQKTQKSQPKFSTNTRILVISDDENNLPSLKTKSNNSKPKIIDISDSDEDELPSLETVLKNITKFAEYKNKQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.27
4 0.22
5 0.23
6 0.21
7 0.18
8 0.2
9 0.22
10 0.26
11 0.28
12 0.37
13 0.43
14 0.48
15 0.56
16 0.63
17 0.7
18 0.75
19 0.81
20 0.82
21 0.82
22 0.86
23 0.85
24 0.86
25 0.84
26 0.82
27 0.79
28 0.73
29 0.69
30 0.68
31 0.6
32 0.53
33 0.46
34 0.39
35 0.31
36 0.27
37 0.23
38 0.14
39 0.12
40 0.11
41 0.1
42 0.1
43 0.1
44 0.09
45 0.07
46 0.08
47 0.1
48 0.13
49 0.16
50 0.21
51 0.32
52 0.42
53 0.51
54 0.53
55 0.58
56 0.56
57 0.6
58 0.59
59 0.49
60 0.43
61 0.36
62 0.4
63 0.34
64 0.33
65 0.27
66 0.23
67 0.22
68 0.19
69 0.16
70 0.09
71 0.08
72 0.08
73 0.08
74 0.08
75 0.09
76 0.13
77 0.16
78 0.15
79 0.17
80 0.18
81 0.19
82 0.21
83 0.27
84 0.34